Vaccinia Virus

Variola Virus

Fowlpox Virus

Protein NPH-II
CVA083
NPH-II
NTP2
Database Links

Group Alignment

A9J1M6|NPH-II_Vaccinia.       -MEKNLPDIFFFPNCVNVFSYKYSQDEFSNMSKTERDSFSLAVFPVIKHR

Q0N848|NPH-II_Variola.        -MEKNLPDIFFFPNCVNVFSYKYSQDEFSNMSNMERDSFSLAVFPVIKHR

O72904|NTP2_Fowlpox.          MTTNDLFSIYAFSNMYDIFPRKYSQKELEEYHRKNPLFFSYTIFPVIKHR

                                 ::* .*: *.*  ::*. ****.*:.:  . :   ** ::*******

 

A9J1M6|NPH-II_Vaccinia.       WHNAHVVKHKGIYKVSTEARGKK----VSPPSLGKPAHINLTAKQYIY--

Q0N848|NPH-II_Variola.        WHNAHVVKHKGIYKVSTEAHGKK----VSPPSLGKPSHINLTAKQYIY--

O72904|NTP2_Fowlpox.          WSKAYICFQNNVYMLNIELDTSKPYDRVPIQHLIDIRPISTDIKKEIYKI

                              * :*::  ::.:* :. *   .*    *.   * .   *.   *: ** 

 

A9J1M6|NPH-II_Vaccinia.       -SEHTISFECYSFLKCITNTEINSFDEYILRGLLEAGNSLQIFS-NSVGK

Q0N848|NPH-II_Variola.        -SEHTISFECYSFLKCITNAEINSFDEYILRGLLEAGNSLQIFS-NSVGK

O72904|NTP2_Fowlpox.          SDKTFITFECYSYLKCKGYNSIYDITLDDKRGLLSAGNILSIFSSNKQMP

                               .:  *:*****:***    .* .:     ****.*** *.*** *.  

 

A9J1M6|NPH-II_Vaccinia.       RTDTIGVLGNKYPFSKIPLASLTPKAQREIFSAWISHRPVVLTGGTGVGK

Q0N848|NPH-II_Variola.        RTDTIGVLGNKYPFSKIPLASLTPKAQREIFSAWISHRPVVLTGGTGVGK

O72904|NTP2_Fowlpox.          EKSSIGILKNPKPFTVIKFKSLSLITQLQIFELLRKRKQIVVTGSTGIGK

                              ...:**:* *  **: * : **:  :* :**.   .:: :*:**.**:**

 

A9J1M6|NPH-II_Vaccinia.       TSQVPKLLLWFNYLFGGFSTLDKIT-DFHERPVILSLPRIALVRLHSNTI

Q0N848|NPH-II_Variola.        TSQVPKLLLWFNYLFGGFSTLDKIT-DFHERPVILSLPRIALVRLHSNTI

O72904|NTP2_Fowlpox.          TSQLPKVIMWYNYLFGGWDNLDRVRFDYISRPIVLSLPRVALVKSNGINF

                              ***:**:::*:******:..**::  *: .**::*****:***: :. .:

 

A9J1M6|NPH-II_Vaccinia.       LKSLGFKVLDGSPISLRYGSIPEELINKQPKKYGIVFSTHKLSLTKLFSY

Q0N848|NPH-II_Variola.        LKSLGFKVLDGSPISLRYGSIPEELINKQPKKYGIVFSTHKLSLTKLFSY

O72904|NTP2_Fowlpox.          LQSLGFSDFEGSPVELRYGGKTEHTTRQHD---GIVLSTNKLTSYSLSNY

                              *:****. ::***:.****. .*.  .::    ***:**:**:  .* .*

 

A9J1M6|NPH-II_Vaccinia.       GTLIIDEVHEHDQIGDIIIAVARKHHTKIDSMFLMTATLEDDRERLKVFL

Q0N848|NPH-II_Variola.        GTLIIDEVHEHDQIGDIIIAVARKHHTKIDSMFLMTATLEDDRERLKVFL

O72904|NTP2_Fowlpox.          NIIIVDEIHEHDRIADIIISVLRKNIDTIHSLVLMSATLEDDRDRLQEFL

                              . :*:**:****:*.****:* **:  .*.*:.**:*******:**: **

 

A9J1M6|NPH-II_Vaccinia.       PNPAFIHIPGDTLFKISEVFIHNKINPSSRMAYIEEEKRNLVTAIQMYTP

Q0N848|NPH-II_Variola.        PNPAFIHIPGDTLFKISEVFIHNKINPSSRMAYIEEEKRNLVTAIQMYTP

O72904|NTP2_Fowlpox.          PDVEFYHIEGPVLYSIKEIYVKNKYSYDS-KAYTEEEKKNISTTLNWCRP

                              *:  * ** * .*:.*.*::::** . .*  ** ****:*: *:::   *

 

A9J1M6|NPH-II_Vaccinia.       PDGSSGIVFVASVAQCHEYKSYLEKRLP-YDMYIIHGKVLDIDEILEKVY

Q0N848|NPH-II_Variola.        PDGSSGIVFVASVAQCHEYKSYLEKRLP-YDMYIIHGKVLEIDKILEKVY

O72904|NTP2_Fowlpox.          RNGMCGILFLASVSQCISYKKYLEKSNSDMDFIIIHGKIPDITEVLNAVQ

                               :* .**:*:***:** .**.****  .  *: *****: :* ::*: *

 

A9J1M6|NPH-II_Vaccinia.       SS--PNVSIIISTPYLESSVTIRNVTHIYDMGRVFVPAPFGGSQQFISKS

Q0N848|NPH-II_Variola.        SS--PNVSIIISTPYLESSVTIHNVTHIYDMGRVFVPAPFGGSQQFISKS

O72904|NTP2_Fowlpox.          RPGRERPCILVSTPYLESSITIRTATHVYDTGRVYVPKPFGGDQLFISKS

                               .   . .*::********:**:..**:** ***:** ****.* *****

 

A9J1M6|NPH-II_Vaccinia.       MRDQRKGRVGRVNPGTYVYFYDLSYMKSIQRIDSEFLHNYILYANKFNLT

Q0N848|NPH-II_Variola.        MRDQRKGRVGRVNPGTYVYFYNLSYMKSIQRINSEFLHNYILYANKFNLT

O72904|NTP2_Fowlpox.          MMTQRKGRVGRVSKGIYVYFYDMCLLKPIKSIDHEFLYEYIVYAKKFKLS

                              *  *********. * *****::. :*.*: *: ***::**:**:**:*:

 

A9J1M6|NPH-II_Vaccinia.       LPEDLFIIPTNLDILWRTKEYIDSFDISTETWNKLLSNYYMKMIEYAKLY

Q0N848|NPH-II_Variola.        LPEDLFIIPTNLDILWRTKEYIDSFDISTETWNKLLSNYYMKMIEYAKLY

O72904|NTP2_Fowlpox.          LPNDLLVIPSDKDMLKKSEEYIKSFNISFDRLFEIYVNYFVNMVEYVKIY

                              **:**::**:: *:* :::***.**:** :   ::  **:::*:**.*:*

 

A9J1M6|NPH-II_Vaccinia.       VLSPILAEELDNFERTGELTSIVQEAILSLNLRIKILNFKHKDDDTYIHF

Q0N848|NPH-II_Variola.        VLSPILAEELDNFERTGELTSIVQEAILSLNLRIKILNFKHKDNDTYIHF

O72904|NTP2_Fowlpox.          NKGGKKAENLDMFERNDILTGETLKDIKNLQLLVKINTTTRR-KKMYCYK

                                .   **:** ***.. **. . : * .*:* :** . .:: .. * :

 

A9J1M6|NPH-II_Vaccinia.       CKILFGVYNGTNATIYYHRPLTGYMNMISDTIFVPVDNN

Q0N848|NPH-II_Variola.        CKILFGVYNGTNATIYYHRPLTGYMNMISDTIFVPVDNN

O72904|NTP2_Fowlpox.          GEILFGPYMNTVIRLSSKQLYRNYVYMLTERSFTLYR--

                               :**** * .*   :  ::   .*: *:::  *.