Plum-pox-Virus

Lily-mottle-Virus

Turnip-Mosaic-Virus

Protein CI
(Cytoplasmic inclusion protein)
CI
(Cytoplasmic inclusion protein)
CI
(Cytoplasmic inclusion protein)
Database Links Genome polyprotein
Genome polyprotein
Genome polyprotein

Group Alignment

P13529|CI_Plum-pox-V.           VAFVALVMMLFDSERSDGVYKILNKLKGIMGSVDQA-VHHQSLDDIEDIL

Q4GXV0|CI_Lily-mottle-V.        --------MVFDADRSDCVYKVLNKLKGLLNTVHQEPVKFQSIDDIQDYL

Q0EDF4|CI_Turnip-Mosaic-V.      IAFIALVLMMFDAERSDCVTKILNKLKGLVSTVEPA-VYHQTLNDIEDDL

                                        *:**::*** * *:******::.:*.   * .*:::**:* *

 

P13529|CI_Plum-pox-V.           DEKKLTVDFVLQSN-EVAPTVPFDSTFEKWWTNQLETGNVIPHYRTEGHF

Q4GXV0|CI_Lily-mottle-V.        EEREMVIDFEISAD-DHNINKLAGATFEQWWSNQMECNNVLPHYRTEGFF

Q0EDF4|CI_Turnip-Mosaic-V.      SERNLFVDFELSNDGEILQQLPAEKTFASWWNHQLSRGFTIPHYRTEGKF

                                .*::: :** :. : :         ** .**.:*:. . .:******* *

 

P13529|CI_Plum-pox-V.           LEFTRENAAHIANEVMHGSHQDILIRGAVGSGKSTGLPFHLSKKGHVLLI

Q4GXV0|CI_Lily-mottle-V.        MEFTRANAAHVANEIAHGPHKDLLIRGAVGSGKSTGLPFYLSKRGRVLML

Q0EDF4|CI_Turnip-Mosaic-V.      MTFTRATATEVAGKIAHESDRDILLMGAVGSGKSTGLPYHLSRKGNVLLL

                                : *** .*:.:*.:: * ..:*:*: ************::**::*.**::

 

P13529|CI_Plum-pox-V.           EPTRPLAENVCKQLRGQPFNVNPTLRMRGMSTFGSTPITVMTSGYALHFL

Q4GXV0|CI_Lily-mottle-V.        EPTRPLASNVHKQLAGDPFLVSATLKMRGETTFGSAPITVMTSGYAFHYY

Q0EDF4|CI_Turnip-Mosaic-V.      EPTRPLAENVHKQLSQAPFHQNTTLRMRGLTSFGSAPISVMTSGFALNYF

                                *******.** ***   **  ..**:*** ::***:**:*****:*:::

 

P13529|CI_Plum-pox-V.           ANNPTYLDNYKCIIFDECHVHDASAMAFRCLLSEYSYPGKILKVSATPPG

Q4GXV0|CI_Lily-mottle-V.        ANNPNQLRDFEFIIFDECHVNDSSAMAFRSLLAEYTYDGRIIKVSATPPG

Q0EDF4|CI_Turnip-Mosaic-V.      ANNRTRIEEFDFVIFDECHVHDANAMAMRCLLHECDYSGKVIKVSATPPG

                                *** . : ::. :*******:*:.***:*.** *  * *:::********

 

P13529|CI_Plum-pox-V.           HEVDFKTQKEVKVIVEESLSFQQFVSNLGTGCNSDILKHGVNVLVYVASY

Q4GXV0|CI_Lily-mottle-V.        REVEFATQHPVEIIPIERLTFQQFVAVQGTGAVGDVTTKGDNILVYVASY

Q0EDF4|CI_Turnip-Mosaic-V.      REVEFSTQYPVTISTEDTLSFQDFVNAQGSGSNCDVISKGDNILVYVASY

                                :**:* **  * :   : *:**:**   *:*.  *: .:* *:*******

 

P13529|CI_Plum-pox-V.           NEVDTLSKLLTDRSFKVSKVDGRTMKIGNVEIPTSGTQAKPHFVVATNII

Q4GXV0|CI_Lily-mottle-V.        SEVDNLSKGLVEKGHKVTKVDGRTMKVGGVEIITSGSQAKKHFVVATNII

Q0EDF4|CI_Turnip-Mosaic-V.      NEVDTLSKLLVERDFKVTKVDGRTMKVGNIEITTSGTPSRKHFIVATNII

                                .***.*** *.::..**:********:*.:** ***: :: **:******

 

P13529|CI_Plum-pox-V.           ENGVTLDIDVVVDFGLKVVPVLDIDNRLVRYTKKSISYGERIQRLGRVGR

Q4GXV0|CI_Lily-mottle-V.        ENGVTLDIDVVVDFGLKVVAEVDIDSRLTRYVKKSISYGERIQRLGRVGR

Q0EDF4|CI_Turnip-Mosaic-V.      ENGVTLDIDVVADFGTKVLPYLDTDNRMLSTTKTSINYGERIQRLGRVGR

                                ***********.*** **:. :* *.*:   .*.**.*************

 

P13529|CI_Plum-pox-V.           NKPGAALRIGFTEKGLTQIPPIIATEAAFLCFTYGLPVMTNGVSTSLLAM

Q4GXV0|CI_Lily-mottle-V.        NKPGAAVRVGTTEKGLQAIPVTTATEAAFLCFAYGLPVMTNNVSTNILTN

Q0EDF4|CI_Turnip-Mosaic-V.      HKPGHALRIGHTEKGLSEVPSCIATEAALKCFTYGLPVITNNVSTSILGN

                                :*** *:*:* *****  :*   *****: **:*****:**.***.:* 

 

P13529|CI_Plum-pox-V.           CTVKQARTMQQFELSPFYTVALVRFDGTMHQEIFRLLKSYRLRDSEVILN

Q4GXV0|CI_Lily-mottle-V.        CTVLQARTMMLFEINPFYMCHFVRFDGTMHPEVHRILTPYKLRDSEIILN

Q0EDF4|CI_Turnip-Mosaic-V.      VTVKQARTMSVFEITPFYTSQVVRYDGSMHPQVHALLKRFKLRDSEIVLN

                                 ** *****  **:.***   .**:**:** ::. :*. ::*****::**

 

P13529|CI_Plum-pox-V.           KLAIPNSNVCGWMSVRDYKRQGCNLDLDENIRVPFYVKDIPETLHERIWQ

Q4GXV0|CI_Lily-mottle-V.        KVAIPNKGLMQWPTAKEYAYQGFKMNIPDTVRLPFHSLDIPERLHERMW-

Q0EDF4|CI_Turnip-Mosaic-V.      KLAIPNRGVNAWLTASEYARLGANVEDRRDVRIPFMCRDIPEKLHLEMWD

                                *:**** .:  * :. :*   * :::    :*:**   **** ** .:*