Yellow Fever Virus

Dengue Fever Virus
DENV1B

Hepatitis C Virus

Protein NS3h NS3h
NS3h
Database Links

Group Alignment

P03314|NS3h_YFV.         IIEECEHLEDGIYGIFQSTFLGASQRGVGVAQGGVFHTMWHVTRGAFLVRNGKKLIPSWA

P27909|NS3h_DENV1B.      -EVERAVLDDGIYRILQRGLLGRSQVGVGVFQDGVFHTMWHVTRGAVLMYQGKRLEPSWA

Q9QP07|NS3h_HCV.         IITSLTGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVFHGAGTKTLAGPKGPITQMYT

                            .    :..        .   :*  :..  .**  *::* :    *      :   ::

 

P03314|NS3h_YFV.         SVKEDLVAYGGSWKLEGRWDGEEEVQLIAAVPGKNVVNVQTKPSLFK-VRNGGEIGAVAL

P27909|NS3h_DENV1B.      SVKKDLISYGGGWRFQGSWNTGEEVQVIAVEPGKNPKNVQTTPGTFK-TPEG-EVGAIAL

Q9QP07|NS3h_HCV.         NVDQDLVG----WQAPPGARSMTPCTCGSSDPYLVTRHADVIPVRRRGDCRGSLLSPRPI

                         .*.:**:.    *:              :  *     :.:. *   :   .*  :.. .:

 

P03314|NS3h_YFV.         DYPSGTSGSPIVNRNGEVIGLYGNGILVG----DNSFVSAISQTEVKEEGKEELQEIP-T

P27909|NS3h_DENV1B.      DFKPGTSGSPIVNREGKIVGLYGNGVVTT----SGTYVSAIAQAKASQEG--PLPEIEDE

Q9QP07|NS3h_HCV.         SYLKGSSGGPLLCPSGHAVGNFRAAVCTRGVAKAVDFIPVESMETTMRSPVFTDNSSPPA

                         .:  *:**.*::  .*. :* :  .: .        ::.. :   . ..      .   

 

P03314|NS3h_YFV.         MLKKGMTTVLDFHPGAGKTRRFLPQILAECARRRLRTLVLAPTRVVLSEMKEAFHGLDVK

P27909|NS3h_DENV1B.      VFKKRNLTIMDLHPGSGKTRRYLPAIVREAIKRKLRTLILAPTRVVASEMAEALKGMPIR

Q9QP07|NS3h_HCV.         VPQTFQVAHLHAPTGSGKSTKV-PAAYATQG---YKVLVLNPSVAATLGFGAYMSKAYGT

                         : :.   : :.  .*:**: :  *    :        *.* *.         

 

P03314|NS3h_YFV.         FHTQAFSAHGSGREVIDAMCHATLTYRMLEPTRVVNWEVIIMDEAHFLDPASIAARGWAA

P27909|NS3h_DENV1B.      YQTTAVKSEHTGREIVDLMCHATFTMRLLSPVRVPNYNMIIMDEAHFTDPASIAARGYIS

Q9QP07|NS3h_HCV.         DPNIRTGVRTITTGAPITYSTYGKFLADGGCSGG-AYDIIICDECHSTDSTTILGIGTVL

                                                                :::** **.*  *.::* . *  

 

P03314|NS3h_YFV.         HRARANESAT-ILMTATPPGTSDEFPHSNGEIEDVQTDIPSEPWNTGHDWILADKRPTAW

P27909|NS3h_DENV1B.      TRVGMGEAAA-IFMTATPPGSVEAFPQSNAVIQDEERDIPERSWNSGYDWITDFPGKTVW

Q9QP07|NS3h_HCV.         DQAETAGARLVVLATATPPGSVT-VPHPNIEEVALSNTGEIPFYGKAIPIEAIKGGRHLI

                          :.    :   .  ******:   .*:.*      .       :...            

 

P03314|NS3h_YFV.         FLPSIRAANVMAASLRKAGKSVVVLNRKTFEREYPTIKQKKPDFILATDIAEMGANLCVE

P27909|NS3h_DENV1B.      FVPSIKSGNDIANCLRKNGKRVIQLSRKTFDTEYQKTKNNDWDYVVTTDISEMGANFRAD

Q9QP07|NS3h_HCV.         FCHSKKKCDELAAKLSALGLNAVAYYRG---LDVSVIPTSGDVVAVATDALMTGFTGDFD

                         *  * :  : :*  *   *  .:   *     :      .     ::**    * .   :

 

P03314|NS3h_YFV.         RVLDCRTAFKPVLVDEG-RKVAIKG-PLRISASSAAQRRGRIGRNPNRDGDSYYYSEPTS

P27909|NS3h_DENV1B.      RVIDPRRCLKPVILKDGPERVILAG-PMPVTVASAAQRRGRIGRNQNKEGDQYVYMGQPL

Q9QP07|NS3h_HCV.         SVIDCNTCVAQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRR---GIYRFVTP--

                          *:* . ..  .:  .    . :   .:   . * :***** **. .   . * :     

 

P03314|NS3h_YFV.         ENNAHHVCWLEASMLLDNMEVRGGMVAPLYGVEGTKTPVSPGEMRLRDDQRKVFRELVRN

P27909|NS3h_DENV1B.      NNDEDHAHWTEAKMLLDNINTPEGIIPALFEPEREKSAAIDGEYRLRGEARKTFVELMRR

Q9QP07|NS3h_HCV.         --GERPLGMFDSSVLCECYDAG----CAWYELTPAETSVRLRAYLNTPGLP------VCQ                           .       ::.:* :  :.               ::..                : .

 

P03314|NS3h_YFV.         CDLPVWLSWQVAKAGLKTNDRKWCFEGPEEHEILNDSGETVKCRAPGGAKKPLRPRWCDE

P27909|NS3h_DENV1B.      GDLPVWLSYKVASEGFQYSDRRWCFDGERNNQVLEEN-MDVEIWTKEGERKKLRPRWLDA

Q9QP07|NS3h_HCV.         DHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLT

                          .* .* *  ..   :.        :.  :   *      *   :     .  :     

 

P03314|NS3h_YFV.         RVSSDQSALSEFI

P27909|NS3h_DENV1B.      RTYSDPLALREFK

Q9QP07|NS3h_HCV.         RLKPTLHGPTPLL

                         *  .   .   :