S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Upf1p
YMR080C
SMG-2
WP:CE28367
CG1559 Rent1
Rent1a/b
RENT1
Database Links
Cellular Function RNA decay (cytoplasmic)

Group Alignment

gi|18375673|RENT1_H.s.   --MSVEAYGPS-SQTLTFLDTEEAE-LLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGG

gi|170784813|Rent1_M.m.  --MSVEAYGPS-SQTLTFLDTEEAE-LLGADTQGSEFEFTDFTLPSQTQTPPGGP-----

gi|18859757|Upf1_D.m.    --MSVDTYAPS--SALSFLDMDDNELLPGADTQPTQYDYRDFTMPSTSQSQTQND-----

gi|17510163|Smg-2_C.e.   MDDSDDEYSRSHGETLTFVDPEDDGVSIG-NTQDSQFAYEQFSVPTQSSQATD-------

YMR080C_S.c.             --------------------------MVG---SGSHTPYDISNSPSDVNVQPATQ-----

 

 

gi|18375673|RENT1_H.s.   GGAGGPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTY---

gi|170784813|Rent1_M.m.  GGAGGPGGAGAGGAAGQLDAQVGPEGILQNGAVDDSVAKTSQLLAELNFEEDEEDTY---

gi|18859757|Upf1_D.m.    --------------------QLEIAQRCSAGDSHPRLASITNDLADLQFEEEDDEPGSS-

gi|17510163|Smg-2_C.e.   ---------------------------LLPGGTDGT-------TNDLPFHDVEDDESDSE

YMR080C_S.c.             ---------------------------LNSTLVEDDD------VDNQLFEEAQVTETGF-

 

 

gi|18375673|RENT1_H.s.   -------YTKDLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCK

gi|170784813|Rent1_M.m.  -------YTKDLPVHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCK

gi|18859757|Upf1_D.m.    -------YVKELPPHACKYCGIHDPATVVMCNNCRKWFCNGRGSTSGSHIINHLVRAKHR

gi|17510163|Smg-2_C.e.   KSLTEEQQQQKLPEHACRYCGISDPLCVAKCTVCRKWFCNSNDGTSGGHIVHHMVRSQHK

YMR080C_S.c.             -------RSPSASDNSCAYCGIDSAKCVIKCNSCKKWFCNTKNGTSSSHIVNHLVLSHHN

 

 

gi|18375673|RENT1_H.s.   EVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDS

gi|170784813|Rent1_M.m.  EVTLHKDGPLGETVLECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDS

gi|18859757|Upf1_D.m.    EVTLHGEGPLGETILECYSCGVRNVFVLGFIPAKADSVVVLLCRQPCAAQNSLKDMNWDQ

gi|17510163|Smg-2_C.e.   EAYTHKDSPCGDTQLECYRCGSKNVFNLGFIPGKKDQVVVIICRTPCASIAFQNDDNWSP

YMR080C_S.c.             VVSLHPDSDLGDTVLECYNCGRKNVFLLGFVSAKSEAVVVLLCRIPCAQT---KNANWDT

 

 

gi|18375673|RENT1_H.s.   SQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVD

gi|170784813|Rent1_M.m.  SQWQPLIQDRCFLSWLVKIPSEQEQLRARQITAQQINKLEELWKENPSATLEDLEKPGVD

gi|18859757|Upf1_D.m.    EQWKPLIADRCFLAWLVKQPSEQGQLRARQISAAQINKLEELWKENIEATFQDLEKPGID

gi|17510163|Smg-2_C.e.   EDWKSVIAEKQLLSWIVNVPSEEQVARARKITATQAVRMEELWRDHPEATVDDLNKPGLD

YMR080C_S.c.             DQWQPLIEDRQLLSWVAEQPTEEEKLKARLITPSQISKLEAKWRSNKDATINDIDAPEEQ

 

 

gi|18375673|RENT1_H.s.   EEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFT

gi|170784813|Rent1_M.m.  EEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAFFT

gi|18859757|Upf1_D.m.    SEPAHVLLRYEDGYQYEKTFGPLVRLEAEYDQKLKESATQENIEVRWDVGLNKKTIAYFT

gi|17510163|Smg-2_C.e.   REPDHVQLRYVDAHHYSKVFRPLVAIEAEYDRRVKESASQAVGTVRWEQGLRQSVLAFFH

YMR080C_S.c.             EAIPPLLLRYQDAYEYQRSYGPLIKLEADYDKQLKESQALEHISVSWSLALNNRHLASFT

 

 

gi|18375673|RENT1_H.s.   LPKTDS-----------DMRLMQGDEICLRYKGDLA-PLWKGIGHVIKVPDNYGDEIAIE

gi|170784813|Rent1_M.m.  LPKTDSGNEDLVIIWLRDMRLMQGDEICLRYKGDLA-PLWKGIGHVIKVPDNYGDEIAIE

gi|18859757|Upf1_D.m.    LAKTDS-----------DMKLMHGDELRLHYVGELY-NPWSEIGHVIKVPDNFGDDVGLE

gi|17510163|Smg-2_C.e.   LPQFADG----------VMKLAKGDELRLKHSQTVDGSEWTKIGSVFKIPDNHGDEVGIE

YMR080C_S.c.             LSTFESN----------ELKVAIGDEMILWYSGMQH-PDWEGRGYIVRLPNSFQDTFTLE

 

 

gi|18375673|RENT1_H.s.   LRSSVGAPV-EVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGH----E

gi|170784813|Rent1_M.m.  LRSSVGAPV-EVTHNFQVDFVWKSTSFDRMQSALKTFAVDETSVSGYIYHKLLGH----E

gi|18859757|Upf1_D.m.    LKSSTNAPV-KCTSNFTVDFIWKCTSFDRMTRALCKFAIDRNSVSNFIYSRLLGHGRADS

gi|17510163|Smg-2_C.e.   IRGAVDKSVMESRIMFTVDVVWNATTFERQYKALAALLNDSKAISPYLYQKLLGH----P

YMR080C_S.c.             LKPSKTPPPTHLTTGFTAEFIWKGTSYDRMQDALKKFAIDKKSISGYLYYKILGH----Q

 

 

gi|18375673|RENT1_H.s.   VEDVIIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHL

gi|170784813|Rent1_M.m.  VEDVVIKCQLPKRFTAQGLPDLNHSQVYAVKTVLQRPLSLIQGPPGTGKTVTSATIVYHL

gi|18859757|Upf1_D.m.    NDEVLFRGPQPKLFSAPHLPDLNRSQVYAVKHALQRPLSLIQGPPGTGKTVTSATIVYQL

gi|17510163|Smg-2_C.e.   AEEMMLKFDLPRRLSVAGLPELNSSQMQAVKQVLTRPLSLIQGPPGTGKTVVSATIVYHL

YMR080C_S.c.             VVDISFDVPLPKEFSIPNFAQLNSSQSNAVSHVLQRPLSLIQGPPGTGKTVTSATIVYHL

 

 

gi|18375673|RENT1_H.s.   ARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMD

gi|170784813|Rent1_M.m.  ARQGNGPVLVCAPSNIAVDQLTEKIHQTGLKVVRLCAKSREAIDSPVSFLALHNQIRNMD

gi|18859757|Upf1_D.m.    VKLHGGTVLVCAPSNTAVDQLTEKIHRTNLKVVRVCAKSREAIDSPVSFLALHNQIRNME

gi|17510163|Smg-2_C.e.   VQKTEGNVLVCSPSNIAVDHLAEKIHKTGLKVVRLCARSREHSETTVPYLTLQHQLKVMG

YMR080C_S.c.             SKIHKDRILVCAPSNVAVDHLAAKLRDLGLKVVRLTAKSREDVESSVSNLALHNLVGR-G

 

 

gi|18375673|RENT1_H.s.   SMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQ

gi|170784813|Rent1_M.m.  SMPELQKLQQLKDETGELSSADEKRYRALKRTAERELLMNADVICCTCVGAGDPRLAKMQ

gi|18859757|Upf1_D.m.    TNSELKKLQQLKDETGELSSADEKRYRNLKRAAENQLLEAADVICCTCVGAGDGRLSRVK

gi|17510163|Smg-2_C.e.   G-AELQKLIQLKDEAGELEFKDDLRYMQLKRVKEHELLAAADVICCTCSSAADARLSKIR

YMR080C_S.c.             AKGELKNLLKLKDEVGELSASDTKRFVKLVRKTEAEILNKADVVCCTCVGAGDKRLD-TK

 

 

gi|18375673|RENT1_H.s.   FRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLV

gi|170784813|Rent1_M.m.  FRSILIDESTQATEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAAKAGLSQSLFERLV

gi|18859757|Upf1_D.m.    FTSILIDESMQSTEPECMVPVVLGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLFERLV

gi|17510163|Smg-2_C.e.   TRTVLIDESTQATEPEILVSIMRGVRQLVLVGDHCQLGPVVICKKAAIAGLSQSLFERLV

YMR080C_S.c.             FRTVLIDESTQASEPECLIPIVKGAKQVILVGDHQQLGPVILERKAADAGLKQSLFERLI

 

 

gi|18375673|RENT1_H.s.   VLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFY

gi|170784813|Rent1_M.m.  VLGIRPIRLQVQYRMHPALSAFPSNIFYEGSLQNGVTAADRVKKGFDFQWPQPDKPMFFY

gi|18859757|Upf1_D.m.    VLGIRPFRLEVQYRMHPELSQFPSNFFYEGSLQNGVCAEDRRLK-LDFPWPQPERPMFFL

gi|17510163|Smg-2_C.e.   LLGIRPFRLQVQYRMHPVLSEFPSNVFYDGSLQNGVTENDRHMTGVDWHWPKPNKPAFFW

YMR080C_S.c.             SLGHVPIRLEVQYRMNPYLSEFPSNMFYEGSLQNGVTIEQRTVPNSKFPWPIRGIPMMFW

 

 

gi|18375673|RENT1_H.s.   VTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQF

gi|170784813|Rent1_M.m.  VTQGQEEIASSGTSYLNRTEAANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQF

gi|18859757|Upf1_D.m.    VTQGQEEIAGSGTSFLNRTEAANVEKITTRFLKAGIKPEQIGIITPYEGQRAYLVQYMQY

gi|17510163|Smg-2_C.e.   HCSGSEELSASGTSFLNRTEAANVEKLVSKLIKAGVQPHQIGVITPYEGQRSFIVNYMHT

YMR080C_S.c.             ANYGREEISANGTSFLNRIEAMNCERIITKLFRDGVKPEQIGVITPYEGQRAYILQYMQM

 

 

gi|18375673|RENT1_H.s.   SGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYG

gi|170784813|Rent1_M.m.  SGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYG

gi|18859757|Upf1_D.m.    QGSLHSRLYQEIEIASVDAFQGREKDIIIMSCVRSNERQGIGFLNDPRRLNVALTRAKFG

gi|17510163|Smg-2_C.e.   QGTLNSKLYENVEIASVDAFQGREKDYIIVTCVRSNDILGIGFLSDPRRLNVAITRAKYG

YMR080C_S.c.             NGSLDKDLYIKVEVASVDAFQGREKDYIILSCVRANEQQAIGFLRDPRRLNVGLTRAKYG

 

 

gi|18375673|RENT1_H.s.   VIIVGNPKALSKQPLWNHLLNYYKEQKVLVEGPLNNLRESLMQFSKP--RKLVNTINPGA

gi|170784813|Rent1_M.m.  VIIVGNPKALSKQPLWNHLLSYYKEQKALVEGPLNNLRESLMQFSKP--RKLVNTVNPGA

gi|18859757|Upf1_D.m.    IIIVGNPKVLAKQQLWNHLLNFYKDRKVLVEGSLNNLKESLIHFQKP--KKLVNSMNIGA

gi|17510163|Smg-2_C.e.   LVLVGNAKVLARHDLWHELINHYKSKEMLYEGPINALKPLNLALPKATIRTKNNIAGNAN

YMR080C_S.c.             LVILGNPRSLARNTLWNHLLIHFREKGCLVEGTLDNLQLCTVQLVRPQPRKTERPMN--A

 

 

gi|18375673|RENT1_H.s.   RF-MTTAMYDAREAIIPGSVYDRSS---QGRP---------------------SSMYFQT

gi|170784813|Rent1_M.m.  RF-MTTAMYDAREAIIPGSVYDRSS---QGRP---------------------SNMYFQT

gi|18859757|Upf1_D.m.    HF-MSTIIADAKEVMVPGSIYDRSGGYGQGRQMVGQSMNGGQYGGSGGGPYGNSPLGYGT

gi|17510163|Smg-2_C.e.   RFGIKRMQYTFNE--------YKSNDPSQPRL---------------------PPTYSNS

YMR080C_S.c.             QFNVESEMGDFPK--------------------------------------------FQD

 

 

gi|18375673|RENT1_H.s.   --------------------------------------HDQIGMISA--GPSHVAAMNIP

gi|170784813|Rent1_M.m.  --------------------------------------HDQISMISA--GPSHVAAMNIP

gi|18859757|Upf1_D.m.    PSSNSMVGFGLGNGGNGAAGGNNNFGGAGPSWAAAHLHHDSIGYISNEHGAAALGNMPVP

gi|17510163|Smg-2_C.e.   --------------------------------------QNLLSMSKL----AQTFNKNVP

YMR080C_S.c.             --------------------------------------FDAQSMVSF---SGQIGD----

 

 

gi|18375673|RENT1_H.s.   IPFNLVMPPMPP----------------------PGYFGQAN-GPA-AGRGTPKGKTGRG

gi|170784813|Rent1_M.m.  IPFNLVMPPMPP----------------------PGYFGQAN-GPA-AGRGTPKTKTGRG

gi|18859757|Upf1_D.m.    VGMFMNMSNIPPRFYNQHQQAIMAVKQNRAIQQQTGNFSPGNSGPGVTGVGVGRSATPGG

gi|17510163|Smg-2_C.e.   IPAHMMDPNV---------------------------YAAAR-----------------N

YMR080C_S.c.             -------------------------------------FGNAF------------------

 

 

gi|18375673|RENT1_H.s.   GRQKNRFG---LPGPSQTNLPNSQASQDVASQPF-SQGALTQGYISMSQPSQMSQPGLSQ

gi|170784813|Rent1_M.m.  GRQKNRFG---LPGPSQTTLPNSQASQDVASQPF-SQGALTQGYVSMSQPSQMSQPGLSQ

gi|18859757|Upf1_D.m.    NKKTNKLGKSRVTGGGTGGAPLTQGSSVCNAAPY-SQHPMPLS-LQMTQPSGFALS--QQ

gi|17510163|Smg-2_C.e.   QKDRRRGDQRRPPPQAEAAMDLSQGMMSQQSQQYPPQGASSQSQYLLDGASSLSGWSQSQ

YMR080C_S.c.             -------------------VDNTELSSYINNEYW----------NFENFKSAFSQK--QN

 

 

gi|18375673|RENT1_H.s.   PELSQDSYLGDEFKSQIDVALSQDSTYQ--GERAYQHGGVTGLSQ-Y

gi|170784813|Rent1_M.m.  PELSQDSYLGDEFKSQIDVALSQDSTYQ--GERAYQHGGVTGLSQ-Y

gi|18859757|Upf1_D.m.    PELSQD--FGQ--ISQMDGLLSQDVAFNASGERSLNQ-----FSQPY

gi|17510163|Smg-2_C.e.   TTTTTTRHHHHRQNRNSQQQMSQDM------DDIQQKMDDLLFSQDC

YMR080C_S.c.             RNEIDDRNLYQEEASHLNSNFARELQREEQKHELSKDFSNLGI*---