S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Suv3p
YPL029W
Suv3
C08F8.2
Suv3
CG9791
Suv3
Suv3
Database Links
Cellular Function Mitochondrial RNA processing Mitochondrial RNA processing

Group Alignment

Q80YD1|M.M._SUV3       MSLPRCTLLWARLPAGRGAGPRAAPCSALRALVGSFPGASGRVPCLA-ASSSA-------

Q8IYB8|H.S._SUV3       MSFSR-ALLWARLPAGRQAGHRAAICSALRPHFGPFPGVLGQVSVLATASSSA-------

Q9VN03|D.M._SUV3       MQNCRRCISLTGLLR---------MTLYLRPSFS-IDLSLRRLHRAAFLFSRK-------

Q17828|C.E._SUV3       MQMRRASGVLRVLGG-----------LTQRCSTSSTPSSS-RFPAMNSRRKRN-------

P32580|S.C._Suv3p      MALVKYSTVFFPLRSLR------LFVSIKKAYYHSEPHSIDLFHDKDWIVKRPKFLNLPK

                       *   :       *                :            .       .        

 

Q80YD1|M.M._SUV3       -----------SGGSKAPNTSLFVPLTVKPQGPSADGDVGAELTRPLDKNEV-KKILDKF

Q8IYB8|H.S._SUV3       -----------SGGSKIPNTSLFVPLTVKPQGPSADGDVGAELTRPLDKNEV-KKVLDKF

Q9VN03|D.M._SUV3       -----------KPETNLS--TLFKPVQVHAYVDSED--VGSELSGKLEKAEL-LKILNKF

Q17828|C.E._SUV3       -----------SVRKTATIEDIVEPRKVKHVTQTAAG--MGEWIGSLDNTNI-HMSLDEF

P32580|S.C._Suv3p      NEHSKLDIFQFNFNKSESNNVYLQDSSFKDNLDKAMQFIYNDKLSSLDAKQVPIKNLAWL

                                  .  .. .    .    .:    .       :    *:  ::    *  :

 

Q80YD1|M.M._SUV3       YKRQEIQKLSADYGLDARLFHQAFISFRNYIMQSHSLDVD-------IHIVLNDICFSAA

Q8IYB8|H.S._SUV3       YKRKEIQKLGADYGLDARLFHQAFISFRNYIMQSHSLDVD-------IHIVLNDICFGAA

Q9VN03|D.M._SUV3       TQRREIKSLCNENGLDDYLQQQAFGSFRRFCIEAENLPVD-------LHITFSDITQGAG

Q17828|C.E._SUV3       MRRPMVRQLAKENGINDKLFMRSFKSFREYCTPEDLNSVDP-----GLLILLSDISKGTK

P32580|S.C._Suv3p      KLRDYIYQQLKDPKLQAKTYVPSVSEIIHPSSPGNLISLLINCNKISNLVWKSVLKYSLS

                         *  : .   :  ::      :. .: .     .   :          :  . :  . 

 

Q80YD1|M.M._SUV3       HVDDLFPFFLRHAKQIFPVLECKDDLRKIS-----------DLRIPPNWYPEARARQRKI

Q8IYB8|H.S._SUV3       HADDLFPFFLRHAKQIFPVLDCKDDLRKIS-----------DLRIPPNWYPDARAMQRKI

Q9VN03|D.M._SUV3       HIDDIFPYFLRHAKTVFPHLDCMDDLKKIS-----------DLRQPANWYSNARAITRKI

Q17828|C.E._SUV3       DCEMLYPFFLDHAKQVFPHLEAMDDLRIIS-----------DLTRPHNWYPEARSVTRKI

P32580|S.C._Suv3p      NNITTLDKFIHVLQQTFDHVYEQEILPMMTNTDDTDGAHNVDITNPAEWFPEARKIRRHI

                       .       *:   :  *  :   : *  ::           *:  * :*:.:**   *:*

 

Q80YD1|M.M._SUV3       IFHSGPTNSGKTYHAIQRYLSATSGVYCGPLKLLAHEIFEKSNAAGVPCDLVTGEERLTV

Q8IYB8|H.S._SUV3       IFHSGPTNSGKTYHAIQKYFSAKSGVYCGPLKLLAHEIFEKSNAAGVPCDLVTGEERVTV

Q9VN03|D.M._SUV3       VFHAGPTNSGKTYHAMERYLSAKTGVYCGPLKLLATEVYNKANERGTPCDLVTGEERKFG

Q17828|C.E._SUV3       FFHAGPTNSGKTYHALKRFGEAKSAVFCGPLKLLAAEVFHRTNELGIPCDLVTGEERRFA

P32580|S.C._Suv3p      IMHIGPTNSGKTYRALQKLKSVDRGYYAGPLRLLAREVYDRFHAEKIRCNLLTGEEVIRD

                       .:* *********:*:::  ..  . :.***:*** *::.: :     *:*:****   

 

Q80YD1|M.M._SUV3       EPE-GKQATHVSCTVEMCNVATPYEVAVIDEIQMIRDPARGWAWTRALLGLCAEEVHLCG

Q8IYB8|H.S._SUV3       QPN-GKQASHVSCTVEMCSVTTPYEVAVIDEIQMIRDPARGWAWTRALLGLCAEEVHLCG

Q9VN03|D.M._SUV3       ISE-SLPANHVACTVEMTSVNTPYEVAVIDEIQQIRDPQRGWAWTRAFLGLIADEVHVCG

Q17828|C.E._SUV3       KDN-HHPSQHLSSTVEMLSTQMRVEVAVIDEIQMLRDEQRGWAWTRALLGAAADEIHLCG

P32580|S.C._Suv3p      LDDRGNSAGLTSGTVEMVPINQKFDVVVLDEIQMMSDGDRGWAWTNALLGVVSKEVHLCG

                         :    :   : ****       :*.*:**** : *  ******.*:**  :.*:*:**

 

Q80YD1|M.M._SUV3       ESAAINLVSELLYTTGEEVEVQKYERLTPISVLDHALES-LDNLQPGDCIVCFSKNDIYS

Q8IYB8|H.S._SUV3       EPAAIDLVMELMYTTGEEVEVRDYKRLTPISVLDHALES-LDNLRPGDCIVCFSKNDIYS

Q9VN03|D.M._SUV3       EPGALDLLQKICETTGETVEVRLYDRLTELTVENTALGS-LDNIVPGDCIVCFSKHDIYT

Q17828|C.E._SUV3       EPAAIDIVKKLLEPIGETVEVRYYERKSPLAIADKAIES-YSNIEPGDCIVCFSKRSIFF

P32580|S.C._Suv3p      EKSVLPLVKSIVKMTGDKLTINEYERLGKLSVEEKPIKDGIKGLRKGDCVVAFSKKKILD

                       * ..: :: .:    *: : :. *.*   ::: : .: .  ..:  ***:*.***..* 

 

Q80YD1|M.M._SUV3       VSRQIEIRG-LESAVIYGSLPPGTKLAQARKFNDPNDPCKILVATDAIGMGLNLSIRRII

Q8IYB8|H.S._SUV3       VSRQIEIRG-LESAVIYGSLPPGTKLAQAKKFNDPNDPCKILVATDAIGMGLNLSIRRII

Q9VN03|D.M._SUV3       VSREIEARG-KEVAVIYGGLPPGTKLAQAAKFNDPANSCKVMVATDAIGMGLNLSIRRII

Q17828|C.E._SUV3       NSKKLEENG-IKPAVIYGDLPPGTKLAQAAKFNDPDDECNVLVATDAIGMGLNLNIRRVI

P32580|S.C._Suv3p      LKLKIEKDTNLKVAVIYGSLPPETRVQQAALFN--NGEYDIMVASDAIGMGLNLSIDRVV

                        . ::*     : *****.*** *:: **  **   .  .::**:*********.* *::

 

Q80YD1|M.M._SUV3       FYSLIKPSINEKGEKELEPITTSQALQIAGRAGRFSSHFKEG-----QVTTMHRDDLALL

Q8IYB8|H.S._SUV3       FYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKEG-----EVTTMNHEDLSLL

Q9VN03|D.M._SUV3       FYSLIKPSMNERGEREIDTISVSSALQIAGRAGRFRTQWEHG-----YVTAFKSEDLQTL

Q17828|C.E._SUV3       FNSCTR---------QTELLPTYAALQIAGRAGRFGTAYANG-----VATTMRKEDLGTL

P32580|S.C._Suv3p      FTTNMKYN-----GEELMEMTSSQIKQIGGRAGRFKSRSASGGVPQGFITSFESKVLKSV

                       * :  :         :   :.     **.****** :    *       *::. . *  :

 

Q80YD1|M.M._SUV3       KDILNRPVDPIQAAGLHPTAEQIEMFAYHLPE--TTLSNLIDIFVDFAQVDG-QYFVCNM

Q8IYB8|H.S._SUV3       KEILKRPVDPIRAAGLHPTAEQIEMFAYHLPD--ATLSNLIDIFVDFSQVDG-QYFVCNM

Q9VN03|D.M._SUV3       QRILARTPEPIKQAGLHPTADQIELYAYHLPS--SSLSNLMDIFVNLCTVDDSLYFMCNI

Q17828|C.E._SUV3       KAILSEKIEPIANVGIAPTYDQIETFSFHLPQ--ASFVRLLDLFVSVCSVSD-HFFICTV

P32580|S.C._Suv3p      RKAIEAPVEYLKTAVTWPTDEICAQLMTQFPPGTPTSVLLQTISDELEKSSDNLFTLSDL

                       :  :    : :  .   ** :       ::*   .:   *  :  ..   ..  : :. :

 

Q80YD1|M.M._SUV3       DDFKFSAELIQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYSRNEP---LTFAWL

Q8IYB8|H.S._SUV3       DDFKFSAELIQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYSRNEP---LTFAWL

Q9VN03|D.M._SUV3       EDFKFLAEMIQHVALPLRARYVFCCAPINRKMPFVCSMFLKVARQYSRNEP---ITFDFI

Q17828|C.E._SUV3       YDMRELAVLIDQIPLPLKVRYTFCTSPLNTEDKRTSAVFVKMARRFSTGQA---LTYEWL

P32580|S.C._Suv3p      KSKLKVIGLFEHMEDIPFFDKLKLSNAPVKDMPMVTKAFTKFCETIAKRHTRGLLSYRLP

                        .      :::::             .   .   .   : :...  :  ..   :::  

 

Q80YD1|M.M._SUV3       RRYIKWPLLPPKNIKDLMDLEAVHDVFDLYLWLSYRFIDMFPDSSLVRSLQKELDAIIQE

Q8IYB8|H.S._SUV3       RRYIKWPLLPPKNIKDLMDLEAVHDVLDLYLWLSYRFMDMFPDASLIRDLQKELDGIIQD

Q9VN03|D.M._SUV3       KKNCGWPFKLPKTILDLVHLEAVFDVMDLY-----RFMDLFPEAAYVRDAQKELDEIIQQ

Q17828|C.E._SUV3       IDMLEWPPKPATTLNELSLLEQNYEILDQYMWLSMRFPDMLPDEPRVREASKHLDSMIQE

P32580|S.C._Suv3p      FNLLDYNCIP-NESYSLEVYESLYNIITLYFWLSNRYPNYFIDMESAKDLKYFCEMIIFE

                            :     .   .*   *  .:::  *     *: : : :    :. .   : :* :

 

Q80YD1|M.M._SUV3       GVHNITKLIKISESRKLLNLESLPSGDQSRLSGASKSPARRTRGTKSAGNKATEPLSPSD

Q8IYB8|H.S._SUV3       GVHNITKLIKMSETHKLLNLEGFPSGSQSRLSGTLKSQARRTRGTKALGSKATEPPSPDA

Q9VN03|D.M._SUV3       GVFQITRLLKNTEAS--------QDGETS------NYAIRRITHVK-------EPRLPSL

Q17828|C.E._SUV3       GVESFMSLLSVGATES------KAAGSSK------SSEGKRENPSKS------EREKPN-

P32580|S.C._Suv3p      KLDRLKKNPYAHKPFG--------------------------------------------

                        :  :        .                                             

 

Q80YD1|M.M._SUV3       KELPLASRLVQQGLLTADMLRQLQKEWLTQQPEHSREK-----------------VGTRR

Q8IYB8|H.S._SUV3       GELSLASRLVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESGT----------HPKGTRR

Q9VN03|D.M._SUV3       SRGRLTERLLAQGLLTPGMLSELRKEWDAQQLGKSNSQSNENSEPVVNSDDEDNYSGIGR

Q17828|C.E._SUV3       KRSSILEALLKRADISEDDLEQLREELNKNKK----------------------------

P32580|S.C._Suv3p      --------------STRGHLSSSRRRLRT-------------------------------

                                      : . * . ...                                 

 

Q80YD1|M.M._SUV3       KKKDPDSD

Q8IYB8|H.S._SUV3       KKKEPDSD

Q9VN03|D.M._SUV3       KTRKKRRK

Q17828|C.E._SUV3       --------

P32580|S.C._Suv3p      --------