S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Ski2p
YLR398C

F01G4.3
Ski2
CG10210
SkiV2l
SkiV2
Ski2W
Database Links
Cellular Function RNA decay (cytoplasmic)

S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Mtr4p
YJL050W
Mtr4 CG4152
SK2L2
SkiV2l2
SK2L2
SkiV2L2
Database Links
Cellular Function
  • RNA decay (nuclear)
  • Ribosome Biogenesis

Group Alignment

Q15477|H.S.SKIV2       -------------------MMETERLVLPPPDPLDLPLRAVELGCTGHWELLNLPGAPES

Q3TW36|M.M.Skiv2l      -------------------MMETERLVLPPLDPLNLPLRALEVGCTGRWELLNVPGPPES

Q9BI21|D.m.Ski2        --------------------MNEIR------------------GEDNLERLRNYILRPEL

Q19103|C.E.Q19103      -------------------MLEEEAER-----------------LFRLECLETLNWPPCA

P35207|S.c.Ski2p       MSEGFSSSSIQELYQSLKEITNNADVELFEDRITKLDFESTDEPKHANDIIKDRFLRPSN

P42285|H.S.SK2L2       ------------------------------------------------------------

Q9CZU3|M.M.SK2L2       ------------------------------------------------------------

Q9Y134|D.m.CG4152      ------------------------------------------------------------

P47047|S.c.Mtr4p       ------------------------------------------------------------

Q23223|C.E.YH20        ------------------------------------------------------------

                                                                                  

 

Q15477|H.S.SKIV2       SLPHGLPPCAPDLQQEAEQLFLSSPAWLPLHGVEHSARKWQRKTDPWSLLAVLGAPVPSD

Q3TW36|M.M.Skiv2l      TLPHGLPPCAPDLCQEAEQLFLSSPAWLPLHGVEHSARKWQRKTDPWSLLAAVETPVPSD

Q9BI21|D.m.Ski2        SLHNPLPDVLP------------------------------RKFDPMRLLHAPRCPGSTK

Q19103|C.E.Q19103      PIPFHITKQNP------------------------SAEFYNVADNLDSLLQPIDAPAN--

P35207|S.c.Ski2p       ALPWSLLDMVQDVPHTS------------------SPEDCSGKLDYKELLKVPDPINRTS

P42285|H.S.SK2L2       ------------------------------------------------------------

Q9CZU3|M.M.SK2L2       ------------------------------------------------------------

Q9Y134|D.m.CG4152      ------------------------------------------------------------

P47047|S.c.Mtr4p       ------------------------------------------------------------

Q23223|C.E.YH20        ------------------------------------------------------------

                                                                                  

 

Q15477|H.S.SKIV2       LQAQRHPTTGQILGYKEVL--LENTNLSATTSLSLRRPPG-------PASQSLWGNPTRY

Q3TW36|M.M.Skiv2l      LQAQRHPTTGHILGYKEVL--LENTNLSATTSLSLRRPPG-------PASQSLWGNPTQY

Q9BI21|D.m.Ski2        LAPRRD-QSGHILEFVELD--LEAVGANANNSMSMQREPG-------LLEDATRGSHSNF

Q19103|C.E.Q19103      IIAQVD-SNGKIIGFVENE--RIIVG-SANTSMSINRAPYKQRSLHTTAGNSIKGSPGNV

P35207|S.c.Ski2p       YQFKRTGLEGKISGYKEEVDLKEVANANASNSLSITRSIN-------HNQNSVRGSTAQL

P42285|H.S.SK2L2       ------------------------------------------------------------

Q9CZU3|M.M.SK2L2       ------------------------------------------------------------

Q9Y134|D.m.CG4152      ------------------------------------------------------------

P47047|S.c.Mtr4p       ------------------------------------------------------------

Q23223|C.E.YH20        ------------------------------------------------------------

                                                                                   

 

Q15477|H.S.SKIV2       PFWPGGMDEPT------ITDLNTREEAEEEIDFEKD-LLTIPPGFKKGMDFAPKDC----

Q3TW36|M.M.Skiv2l      PFWPGGMDEPS------ITDLHTREEAEEEIDFEKD-LLTVPPGFKKGVDFAPKDH----

Q9BI21|D.m.Ski2        PFWPGGFDE---------QRQQIAALDVSNFQFGDK-LLTVPPGFSSGYDFFQSQS----

Q19103|C.E.Q19103      PFLPGFLEELDDLLAGETTAKSTSGEESKFLSFKDD-ATLLNTIPTIGQIVLPNHSSVKK

P35207|S.c.Ski2p       PFTPGGIPMKSVKTDSEQNGSSTMANATKLLHKDGQGLFDIPEGMNRGIKPMDSPAE--N

P42285|H.S.SK2L2       ----------------------------MADAFGDELFSVF-------EGDSTTAAGTKK

Q9CZU3|M.M.SK2L2       ----------------------------MADAFGDELFSVF-------EDDSTSAAGAKK

Q9Y134|D.m.CG4152      -----------------------MDIEELFDCFDEVTPSVPPPALNQEEKPSGSSASKKG

P47047|S.c.Mtr4p       -----------------------MDSTDLFDVFEETPVELPTDS--NGEKNADTNVGDTP

Q23223|C.E.YH20        -------------------------MADLFDEFIEP-----------------GVKNEIM

                                                                                  

 

Q15477|H.S.SKIV2       PTPAPGLLSLS--CLLEPLDLGGGDEDENEAVGQP-GGPRGDTVSASPCSAPLAR---AS

Q3TW36|M.M.Skiv2l      PAPVPGLLSLS--RLLEPLDLSGGDEDEGEAAG----GPRGDNASPSPSGTPLVR---AS

Q9BI21|D.m.Ski2        VTLPPVVADPSNVDLLENLEQDLDVQEWMKLTRSEETSSTGTPKSPKQSNVQLPSE-EFR

Q19103|C.E.Q19103      PAETPKSINIEEMDMFDLLDMVTSNEYIIHTVAAPVKKSESIESEETPEDDKKVSENEID

P35207|S.c.Ski2p       EDQNGQFKELKQLNEIDNELDIRIEANEAKLKEEEKSAKSISEEIMEEATEETTADNADD

P42285|H.S.SK2L2       DKEKDKGKWKGPPGSADKAGKRFDGKLQSESTNNGKNKRDVDFEGTDEPIFGKKPRIEES

Q9CZU3|M.M.SK2L2       DKEKE--KWKGPPGSADKAGKRLDTKLQSESASGGKNKRDLDVEGTDEPIFGKKPRIEDS

Q9Y134|D.m.CG4152      NKRQADGTTASKEATSSKGAEGDDKGDVTEEPTKRLKQEASTVAVDDDNNADDEPTRTLD

P47047|S.c.Mtr4p       DHTQDKKHGLEEEKEEHEENNSENKKIKSNKSKTEDKNKKVVVPVLADS-FEQEASREVD

Q23223|C.E.YH20        DVEEAPENPMEKLDSAKKRQAREDMTNLLANMHNDVGVGNFDEATSKRARVEEEEEVEEA

                                                                                   

 

Q15477|H.S.SKIV2       SLEDLVLKEASTAVSTPE-APEPPSQEQWAIPVDATSPVG---DFYRLIPQPAFQWAFEP

Q3TW36|M.M.Skiv2l      SLEDLVLKEAATVVSTPE-PPKPPPQEQWAVPVDVTSPVG---DFYRLIPQPAFQWAFEP

Q9BI21|D.m.Ski2        DVDDHIMKADLKPVLNIS-TTTKNFKSDWAEMVDISQPIN---NFKEQIPCPAMDFPFEL

Q19103|C.E.Q19103      EIEIPIIPGNTEKVIEIFGAATEPTKEKFEFAQRLVLSADEEDEYKRLVPTMARKYPFSL

P35207|S.c.Ski2p       AEIDELLPIGIDFGRTKPVSKSVPVKKEWAHVVDLNHKIEN---FDELIPNPARSWPFEL

P42285|H.S.SK2L2       ITEDLSLADLMPRVKVQSVETVEGCTHEVALPAEEDYLPLK----PRVGK-AAKEYPFIL

Q9CZU3|M.M.SK2L2       INEDLSLADLMPRVKVQSVETVEGCTHEVALPADEDYIPLK----PRVGK-AAKEYPFIL

Q9Y134|D.m.CG4152      IDDSATLEALRTRIVTHLLDAPKSCTHEVAAHPDQEYIPLK----PFSGV-PAKEYPFVL

P47047|S.c.Mtr4p       ASKGLTNSETLQVEQDGKVRLSHQVRHQVALPPNYDYTPIA----EHKRVNEARTYPFTL

Q23223|C.E.YH20        RMENIIVHTIRTD--------NENCTHEVAIPPNAEFAELR----ENSGTEPAKYYPFQL

                                                  .                        *  :.* 

 

Q15477|H.S.SKIV2       DVFQKQAILHLERHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTSPIKALSNQKFR

Q3TW36|M.M.Skiv2l      DVFQKQAILHLEQHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTSPIKALSNQKFR

Q9BI21|D.m.Ski2        DVFQKQAILKLEQRQYVFVAAHTSAGKTVVAEYAIALSKRDLTRTIYTSPIKALSNQKYR

Q19103|C.E.Q19103      DPFQQSSVLCMERGESLFVAAHTSAGKTVVAEYAIALCQAHKTRAVYTSPIKALSNQKFR

P35207|S.c.Ski2p       DTFQKEAVYHLEQGDSVFVAAHTSAGKTVVAEYAIAMAHRNMTKTIYTSPIKALSNQKFR

P42285|H.S.SK2L2       DAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYR

Q9CZU3|M.M.SK2L2       DAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYR

Q9Y134|D.m.CG4152      DPFQRQAILCIDNSQSVLVSAHTSAGKTVVAEYAIAKSLAAKQRVIYTTPIKALSNQKFR

P47047|S.c.Mtr4p       DPFQDTAISCIDRGESVLVSAHTSAGKTVVAEYAIAQSLKNKQRVIYTSPIKALSNQKYR

Q23223|C.E.YH20        DAFQKQAILCIDNNQSVLVSAHTSAGKTVVATYAIAKCLREKQRVIYTSPIKALSNQKYR

                       * **  ::  ::. : ::*:********* * **** .     :.::*:*********:*

 

Q15477|H.S.SKIV2       DFRNTFGDV--GLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEWVIFDEVHYIN

Q3TW36|M.M.Skiv2l      DFRNTFGDV--GLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEWVIFDEVHYIN

Q9BI21|D.m.Ski2        DFRKTFKDV--GLITGDLQIEPTASCLIMTTEILRSMLYCGSDVTRDLEWVIFDEVHYIN

Q19103|C.E.Q19103      DFKQIFGDV--GLVTGDIQLHPEAACLIMTTEILRSMLYNGSEVIRDLEWVVFDEVHYIN

P35207|S.c.Ski2p       DFKETFDDVNIGLITGDVQINPDANCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYVN

P42285|H.S.SK2L2       EMYEEFQDV--GLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMR

Q9CZU3|M.M.SK2L2       EMYEEFQDV--GLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMR

Q9Y134|D.m.CG4152      EFTDEFKDV--GLVTGDVTINPSASCLIMTTEILRNMLYRGSEIMREVGWVVFDEIHYMR

P47047|S.c.Mtr4p       ELLAEFGDV--GLMTGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMR

Q23223|C.E.YH20        ELEEEFKDV--GLMTGDVTLNPDASCLVMTTEILRSMLYRGSEIMKEVGWVVYDEIHYMR

                       ::   * **  **:***: :.* * **:*******.*** *::: ::: :*::**:**:.

 

Q15477|H.S.SKIV2       DVERGVVWEEVLIMLPDHVSIILLSATVPNALEFADWIGRLKRRQIYVISTVTRPVPLEH

Q3TW36|M.M.Skiv2l      DAERGVVWEEVLIMLPEHVSIILLSATVPNALEFADWIGRLKRRQIYVISTVARPVPLEH

Q9BI21|D.m.Ski2        NPERGHVWEEVIILLPEHVNIIMLSATVPNTLELADWVGSTKKRKVYVISTLKRPVPLTH

Q19103|C.E.Q19103      NEERGHVWEEVLIMLPAHVKIVMLSATVPNCVEFADWVGRIKNRKINVISTDRRPVPLEH

P35207|S.c.Ski2p       DQDRGVVWEEVIIMLPQHVKFILLSATVPNTYEFANWIGRTKQKNIYVISTPKRPVPLEI

P42285|H.S.SK2L2       DSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTDYRPTPLQH

Q9CZU3|M.M.SK2L2       DSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTDYRPTPLQH

Q9Y134|D.m.CG4152      DKERGVVWEETLILLPDNVRYVFLSATIPNARQFAEWVCHLHKQPCHVVYTDYRPTPLQH

P47047|S.c.Mtr4p       DKERGVVWEETIILLPDKVRYVFLSATIPNAMEFAEWICKIHSQPCHIVYTNFRPTPLQH

Q23223|C.E.YH20        DKERGVVWEETIILMSKNIKQAFLSATIPNARQFAQWVASIKQQPVNVVYTDYRPTPLQH

                       : :** ****.:*::. ::   :****:**  ::*:*:   : :   :: *  **.** 

 

Q15477|H.S.SKIV2       YLFTG-------------------------NSSKTQGELFLLLDSRGAFHTKGYYAAVEA

Q3TW36|M.M.Skiv2l      YLFTG-------------------------NSPKTQGELFLLLDSRGAFHTQGYYAAVEA

Q9BI21|D.m.Ski2        FLYTG-------------------------AGGKSRDDIFLLVDAQGKYLQGNYEKAVER

Q19103|C.E.Q19103      FLYTG-------------------------QDGKTQKDLFKIIDRSGQFILKGYNDAKDS

P35207|S.c.Ski2p       NIWAKKELIPVINQNSEFLEANFRKHKEILNGESAKGAPSKTDNGRGGSTARGGRGGSNT

P42285|H.S.SK2L2       YIFPAG-----------------------------GDGLHLVVDENGDFREDNFNTAMQV

Q9CZU3|M.M.SK2L2       YIFPAG-----------------------------GDGLHLVVDENGDFREDNFNTAMQV

Q9Y134|D.m.CG4152      YIFPAG-----------------------------GDGIHLIVDEKGQFKEDNFTTAMAV

P47047|S.c.Mtr4p       YLFPAH-----------------------------GDGIYLVVDEKSTFREENFQKAMAS

Q23223|C.E.YH20        WIYPVG-----------------------------GEGMYEVVNVKGEFREDKFRDAMSG

                        ::.                                       :  .         .  

 

Q15477|H.S.SKIV2       KKERMSKHAQTFGAKQPTHQGGP--------------AQDRGVYLSLLASLRTRAQLPVV

Q3TW36|M.M.Skiv2l      KKERMSKHAQTFGAKQPTHQGGP--------------AQDRGVYLSLLASLRTRAQLPVV

Q9BI21|D.m.Ski2        KKEMQGKAKG--GGGGPRNHLNA--------------KQEQYTWIGLIDFLRRSNMMPVV

Q19103|C.E.Q19103      KAKIYEKEKAGGAGGRGTQRGGGRGGGGNGGGRNWPGKNDKNIYLNLINYMKCSDQLPMV

P35207|S.c.Ski2p       RDGRGGRGNSTRGGANRGGSRGAGAIGSNKRKFFTQDGPSKKTWPEIVNYLRKRELLPMV

P42285|H.S.SK2L2       LRDAG--DLAKGDQKGRKG-------------GTKGP----SNVFKIVKMIMERNFQPVI<

Q9CZU3|M.M.SK2L2       LRDAG--DLAKGDQKGRKG-------------GTKGP----SNVFKIVKMIMERNFQPVI

Q9Y134|D.m.CG4152      LANAG--EAGKGDQKGRHG-------------GIKGTNAGQTNIFKIVKMIMERNFAPVI

P47047|S.c.Mtr4p       ISNQIGDDPNSTDSRGKKGQTYK---------GGSAKGDAKGDIYKIVKMIWKKKYNPVI

Q23223|C.E.YH20        LATAG--DSAGSFNKRRTGG------------GTQGD----SNVLKIIRSVASNDGLNCI

                                                                     ::  :        :

 

Q15477|H.S.SKIV2       VFTFSRGRCDEQASGLTSLDLTTSSEKSEIHLFLQRCLARLRGSDRQLPQVLHMSELLNR

Q3TW36|M.M.Skiv2l      VFTFSRGRCDEQASGLTSLDLTTSSEKSEIHLFLQRCLARLRGSDRQLPQVLHMSELLRR

Q9BI21|D.m.Ski2        AFTLSRNRCDSNLAALQSVDLNTEKEKGAVQKFFLQCLAKLKPPDRTIPQVLVLKDALER

Q19103|C.E.Q19103      VFVFSRKRCDENAQMLASMNLTTEVEKQHVRLFFSQCVQRLKGSDKELPQVLTMRDLCLR

P35207|S.c.Ski2p       VFVFSKKRCEEYADWLEGINFCNNKEKSQIHMFIEKSITRLKKEDRDLPQILKTRSLLER

P42285|H.S.SK2L2       IFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFSNAIDCLSDEDKKLPQVEHVLPLLKR

Q9CZU3|M.M.SK2L2       IFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFNNAIDCLSDEDKKLPQVEHVLPLLKR

Q9Y134|D.m.CG4152      IFSFSKKDCEIYAMQMAKLDFNTPDEKKLVDEVFNNAMDVLTEEDRRLPQVENVLPLLRR

P47047|S.c.Mtr4p       VFSFSKRDCEELALKMSKLDFNSDDEKEALTKIFNNAIALLPETDRELPQIKHILPLLRR

Q23223|C.E.YH20        VFSFSRKECESYAISLKDMDFNKDHEKGMVKSVYESAIAQLSPEDQKLPQILNILPLLRR

                        * :*:  *:     :  ::: .  **  :  .   .:  *   *: :**:        *

 

Q15477|H.S.SKIV2       GLGVHHSGILPILKEIVEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSMRKHDGSTFR

Q3TW36|M.M.Skiv2l      GLGVHHSGILPILKEIVEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSMRKHDGSTFR

Q9BI21|D.m.Ski2        GIGVHHSGILPILKEIVEMLFQNGLVKLLFATETFAMGVNMPARTVVFDSCKKFDGLEMR

Q19103|C.E.Q19103      GFAVHHSGILPILKEVVELLFQKGYVKILFATETFAMGVNMPARCVVFDSIMKHDGTERR

P35207|S.c.Ski2p       GIAVHHGGLLPIVKELIEILFSKGFIKVLFATETFAMGLNLPTRTVIFSSIRKHDGNGLR

P42285|H.S.SK2L2       GIGIHHGGLLPILKETIEILFSEGLIKALFATETFAMGINMPARTVLFTNARKFDGKDFR

Q9CZU3|M.M.SK2L2       GIGIHHGGLLPILKETIEILFSEGLIKALFATETFAMGINMPARTVLFTNARKYDGKDFR

Q9Y134|D.m.CG4152      GIGIHHGGLLPILKETIEILFGEGLIKALFATETFAMGLNMPARTVLFTAPRKFDGKKFR

P47047|S.c.Mtr4p       GIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTVVFTSVRKWDGQQFR

Q23223|C.E.YH20        GIGVHHSGLMPILKETIEILFGEGLVKVLFATETFSMGLNMPARTVVFTSARKFDGSDNR

                       *:.:**.*::**:** :*:** .* :* *******::*:*:*:: *:*    * **   *

 

Q15477|H.S.SKIV2       DLLPGEYVQMAGRAGRRGLDPTGTVILLCKG-RVPEMADLHRMMMGKPSQLQSQFRLTYT

Q3TW36|M.M.Skiv2l      DLLPGEYVQMAGRAGRRGLDPTGTVILLCKG-RVPEMADLHRMMMGKPSQLQSQFRLTYT

Q9BI21|D.m.Ski2        NLKPGEYIQMAGRAGRRGHDETGTAIIMCKG-SVPPSMELRPMILGLPEKLQSQFILRYA

Q19103|C.E.Q19103      MLNPGEYTQMAGRAGRRGLDLTGTVIIICKDSTVPQPDVLKNLISGQALRLESKFRVTYS

P35207|S.c.Ski2p       ELTPGEFTQMAGRAGRRGLDSTGTVIVMAYN-SPLSIATFKEVTMGVPTRLQSQFRLTYN

P42285|H.S.SK2L2       WISSGEYIQMSGRAGRRGMDDRGIVILMVDE--KMSPTIGKQLLKGSADPLNSAFHLTYN

Q9CZU3|M.M.SK2L2       WISSGEYIQMSGRAGRRGMDDRGIVILMVDE--KMSPTIGKQLLKGSADPLNSAFHLTYN

Q9Y134|D.m.CG4152      WISSGEYIQMAGRAGRRGLDDKGIVILMIDE--KVSPAVGRDIVQGKADPINSAFHLTYN

P47047|S.c.Mtr4p       WVSGGEYIQMSGRAGRRGLDDRGIVIMMIDE--KMEPQVAKGMVKGQADRLDSAFHLGYN

Q23223|C.E.YH20        YITSGEYIQMAGRAGRRGKDDRGTVILMVDS--AMSADDAKQIIKGATDPLNSQFRLTYN

                        :  **: **:******* *  * .*::            : :  * .  ::* * : *

 

Q15477|H.S.SKIV2       MILNLLRVDALRVEDMMKRSFSEFPSRKDSKAHEQALAELTKRLGALEEPDMTGQLVD--

Q3TW36|M.M.Skiv2l      MILNLLRVDALRVEDMMKRSFSEFPSRKDSKAHEQALADLTKRLGALEEPDVTGQLAD--

Q9BI21|D.m.Ski2        VILTCLRIESIKVEDIMKFSFKEFNLKLQLPTQQKQLRLAEDKFAML--PTLGEHLQP--

Q19103|C.E.Q19103      MILNLLRVEQLKIEDMLQRSYVESDSLRESKEKRKSLVDTKNAIQTMSTIECSTCSPNSQ

P35207|S.c.Ski2p       MILNLLRIEALRVEEMIKYSFSENAKETLQPEHEKQIKVLQEELQTIEYKSCEICDND--

P42285|H.S.SK2L2       MVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEES------

Q9CZU3|M.M.SK2L2       MVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEEN------

Q9Y134|D.m.CG4152      MVLNLLRVEEINPEYMLERSFYQFQNQAALPGLHDQVEQKTLELNKLTIKDEHN------

P47047|S.c.Mtr4p       MILNLMRVEGISPEFMLEHSFFQFQNVISVPVMEKKLAELKKDFDGIEVEDEEN------

Q23223|C.E.YH20        MVLNLMRVEGMAVSWIINNSFHQFQSYAKIPEIDKKCVQVERKIASFNFPWENE------

                       ::*. :*:: :  . ::: *: :           .           :            

 

Q15477|H.S.SKIV2       LPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVK-NQEHHNALGVILQVSSNS

Q3TW36|M.M.Skiv2l      LPEYYSWAEELTETQNMIQRRIMESVNGLKSLSVGRVVVVK-NEEHHNALGVILQVSSNS

Q9BI21|D.m.Ski2        LVNFYDKAVEYWKEKHRIMKFVVTQPKIQKELKAGRVIVIT-QGKHYNKLAILLNTKSVP

Q19103|C.E.Q19103      LRDYHDALAVFLRKSEHIWPKLNDENVINKLLCSGRFLIVN-SAQQQLQNECVLLIKELN

P35207|S.c.Ski2p       IEKFLELMLAYKEATVNLMQEMVKSPSILHILKEGRLVAFR-DPNDCLKLGFVFKVSLKD

P42285|H.S.SK2L2       VVIYYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDD-FGWGVVVNFSKKS

Q9CZU3|M.M.SK2L2       VVIYYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDD-FGWGVVVNFSKKS

Q9Y134|D.m.CG4152      IASYHHIRSQLDQHGKQFRQWITKPQYLLPFLQPGRLVKVAAGSQE-YDWGIVLNFKKQD

P47047|S.c.Mtr4p       VKEYHEIEQAIKGYREDVRQVVTHPANALSFLQPGRLVEISVNGKDNYGWGAVVDFAKRI

Q23223|C.E.YH20        MRTLVDLQDQLEATRQRIIQIQREPKYIVGFLHAGRLFKVKSGDRD-FKWGILNQFKKEQ

                       :                .             *  **.. .     .      :      

 

Q15477|H.S.SKIV2       TSRVFTTLVLCDK-PLSQD-PQDR-------GPATAEVPYPDDLVGFKLFLPE-------

Q3TW36|M.M.Skiv2l      TSRVFTTLVLCDK-PVVSDNPRDK-------GPATPDVPHPDDLIGFKLFLPE-------

Q9BI21|D.m.Ski2        GKDTIYKVLVLDH-QFKAKDSNSL-------QQGELYYKILSLTPRNMTFQPV-------

Q19103|C.E.Q19103      NKTLQILVASADADETTNKNAAAI-------GFSKLPKSELSWLTEENSLLSTSKFGTRG

P35207|S.c.Ski2p       AVCVIMTFTKPYK-------------------LPNGEPNHLIYFPKADGYRRR-------

P42285|H.S.SK2L2       NVKPNSGE--LDPLYVVEVLLRCS--------KESLKNSATEAAKP--------------

Q9CZU3|M.M.SK2L2       NVKPNSGE--LDPLYVVEVLLRCS--------KESLKNSATEAAKP--------------

Q9Y134|D.m.CG4152      QSRKNPLK--AEPSVTIDVLLHVS--------EAAAKTGDTEPCK---------------

P47047|S.c.Mtr4p       NKRNPSAVYTDHESYIVNVVVNTMYIDSPVNLLKPFNPTLPEGIRP--------------

Q23223|C.E.YH20        NPDDRNDQ-----IYLCDMMIAIN-------TEGRFDPTNPATLVP--------------

                                                                                  

 

Q15477|H.S.SKIV2       ------GPCDHTVVKLQPGDMAAITTKVLR-VNGEKILEDFSKRQQPKFKKDPPLAAVTT

Q3TW36|M.M.Skiv2l      ------GPCEHTVAKLQPGDVAAISTKVLR-VNGEKISEDFSKRQQQKFRKDPPLAAVTT

Q9BI21|D.m.Ski2        ------GIGGHTVLDIKAIDIISITKSTLK-VDADAIIRNWEQRQLERFKDSPPSGSVVK

Q19103|C.E.Q19103      AAHCSTNIRSFRLCEIPLSGIVAVMKKCAKGVQSGEILQEYNMTQIPRFRDRELSENVKK

P35207|S.c.Ski2p       --------------------------NFPKFQKTDFYMEEVPVTAIEVITKRKFAAPLGK

P42285|H.S.SK2L2       -------------------AKPDEKGEMQVVPVLVHLLSAISSVRLYIPKDLRPVDNRQS

Q9CZU3|M.M.SK2L2       -------------------AKPDEKGEMQVVPVLVHLLSAISTVRLYIPKDLRPVDNRQS

Q9Y134|D.m.CG4152      ---------------------PNERGCMEVVPVAHTLITQISSIRVYFPNDLRSADNRRA

P47047|S.c.Mtr4p       -------------------AEEGEKSICAVIPITLDSIKSIGNLRLYMPKDIRASGQKET

Q23223|C.E.YH20        -------------------GFDLPKRRWIRVPMTIDRITAISAVRLKVPADIDKPDGQMR

                                                                         .        

 

Q15477|H.S.SKIV2       AVQELLRLAQAHPAGPPTLDPVNDLQLKDMSVVE--GGLRARKLEELIQ--GAQCVHS--

Q3TW36|M.M.Skiv2l      AVQELLRLAQSYPAGPPTLDPINDLQLKDVAVVE--GGLRARKLEELIR--GAQCVHS--

Q9BI21|D.m.Ski2        AVTELNQLNESYIDNPDNIKYVNLSKEIIVNADS--EVAMLNYVDHLLRKVGEFLPHTNI

Q19103|C.E.Q19103      LLQQITTAVPGLKSGEIETYTWKELGSFCQNLDTSFDTDLLEKLEYNLN-LPQSFPARHC

P35207|S.c.Ski2p       VIKKDVAALNEFNAETNNILDGKTLKEAINIEKQGLKIHQILLDRTNIRDEIFKLKSIKC

P42285|H.S.SK2L2       VLKSIQEVQKRFPDGIPLLDPIDDMGIQDQGLKK------VIQKVEAFEHRMYSHPLHND

Q9CZU3|M.M.SK2L2       VLKSIQEVQRRFPDGVPLLDPIDDMGIQDQGLKK------VIQKVEAFEHRMYSHPLHND

Q9Y134|D.m.CG4152      VLKTIQEAKKRFPLGPPVLNPIDDMNIKDREFRD------IVNTISQFEKRLEEHPLHKS

P47047|S.c.Mtr4p       VGKSLREVNRRFPDGIPVLDPVKNMKIEDEDFLK------LMKKIDVLNTKLSSNPLTNS

Q23223|C.E.YH20        LDGMMAAATKRFGNQIPLLDPIQDMEIKTVEMKE------LIAREKSLEGRLETHSMTKR

                                             .                        :.          

 

Q15477|H.S.SKIV2       PRFPAQYLKLRERMQIQKEMERLRFLLSD-QSLLLFPEYHQRVEVLRTLGYVDEAGTVKL

Q3TW36|M.M.Skiv2l      PRFPAQYVKLRERMQIQKEMERLRFLLSD-QSLLLLPEYHQRVEVLRTLGYVDEAGTVKL

Q9BI21|D.m.Ski2        AGFEQEFAKVYERRMLEIHIEELRFKNSA-RNLTLYPDYCNKLKVLRALKYIDELDEVTL

Q19103|C.E.Q19103      TRFDEHFSVLRDRIRIERKIESLEYELSS-DALLLSEEYHNRLKVLEALNFVEQK-MVSL

P35207|S.c.Ski2p       PNLSQHIVPKFKAHVIKKKIEELYHLMSD-QNLSLLPDYEKRLAVLKDTEFIDQNHNVLL

P42285|H.S.SK2L2       PNLETVYTLCEKKAQIAIDIKSAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEM

Q9CZU3|M.M.SK2L2       PNLETVYTLCERKAQIALDIKSAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEM

Q9Y134|D.m.CG4152      PELERIHRRYQDKVTLQKQLQDLKAELKAARSLLQMDELKHRKRVLRRMGYCKPGDVIEF

P47047|S.c.Mtr4p       MRLEELYGKYSRKHDLHEDMKQLKRKISESQAVIQLDDLRRRKRVLRRLGFCTPNDIIEL

Q23223|C.E.YH20        DNMKDLKKQFEQKQDAVKELNALKAERKSVQSTLHLEELNNRKRVLRRLGYLGNDDALVL

                         :               .::      .         :   :  **.   :      : :

 

Q15477|H.S.SKIV2       AGRVACAMSS-HELLLTELMFDNALSTLRPEEIAALLSGLVCQSPGDAGDQLP--NTLKQ

Q3TW36|M.M.Skiv2l      AGRVACAMSS-HELLLTELMFDNALSALRPEEIAALLSGLVCQSPGDPGDQLP--STLKQ

Q9BI21|D.m.Ski2        KGKVACEMGQ-NELLITELILCNMFNDLEPAEIAALLSGLVFQAKMQDKPVIP--EALKE

Q19103|C.E.Q19103      KGRIGCEIHH-QELLITELILDYKFHQRSPAELAALLSTLTCQYNSGREMQFGGDTVFGE

P35207|S.c.Ski2p       KGRVACEINSGYELVLTELILDNFLGSFEPEEIVALLSVFVYEGKTREEEPPIVTPRLAK

P42285|H.S.SK2L2       KGRVACEISSADELLLTEMMFNGLFNDLSAEQATALLSCFVFQENSSEMPKLT--EQLAG

Q9CZU3|M.M.SK2L2       KGRVACEISSADELLLTEMMFNGLFNDLSSEQATALLSCFVFQENSSEMPKLT--EQLAG

Q9Y134|D.m.CG4152      KGRVACELSSADELLMTEMIFNGVFNDLTAPQAVALLSCFVCDEKSSESVKSA--TELSG

P47047|S.c.Mtr4p       KGRVACEISSGDELLLTELIFNGNFNELKPEQAAALLSCFAFQERCKEAPRLK--PELAE

Q23223|C.E.YH20        KGSVACELSASDELILTEMLLKGIFNTLDVAQTAALLSCFVFQDKCA-APKLA--TELQT

                        * :.* :    **::**:::   :      : .**** :. :              : 

 

Q15477|H.S.SKIV2       GIERVRAVAKRIGEVQVACGL--NQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGT

Q3TW36|M.M.Skiv2l      GVERVKAVAKRIGEVQVACGL--NQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGT

Q9BI21|D.m.Ski2        CVAAFEQINDTILAEEQRF-----QAAIETDNRLNFGLLEVVYEWARNKPFAEIMKLTTV

Q19103|C.E.Q19103      ISESVKSVLTRLESVASKH----KSQISDLGCEIRFDLMEVVYEWANGTPFYQIMEMTDC

P35207|S.c.Ski2p       GKQRIEEIYKKMLCVFNTHQIPLTQDEAEFLDRKRFAMMNVVYEWARGLSFKEIMEMSPE

P42285|H.S.SK2L2       PLRQMQECAKRIAKVSAEAK--LEIDEETYLSSFKPHLMDVVYTWATGATFAHICKMTDV

Q9CZU3|M.M.SK2L2       PLRQMQECAKRIAKVSAEAK--LEIDEETYLSSFKPHLMDVVYTWATGATFAHICKMTDV

Q9Y134|D.m.CG4152      PLRSMQDLARRIAKVSTECK--LDLDADTYVDKFKPFLMDVVLAWCKGSSFLAVCKMTDI

P47047|S.c.Mtr4p       PLKAMREIAAKIAKIMKDSK--IEVVEKDYVESFRHELMEVVYEWCRGATFTQICKMTDV

Q23223|C.E.YH20        CLSELHEQARNVAKVSNECK--MEVMEDKYVSSFNPGLMDVVYQWVNGATFSEIVKTTDV

                           ..     :                      .  :::**  *  . .*  :   : 

 

Q15477|H.S.SKIV2       PEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLYTQ-

Q3TW36|M.M.Skiv2l      PEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLYTQ-

Q9BI21|D.m.Ski2        QEGIIVRCIQQLNETVRDVKTAAIRIGNPGLQSKMEEASAAIKRDIVFTASLYTEL

Q19103|C.E.Q19103      QEGLIVKCIQRLDEVCKDVRNAGRIVGDPALVEKMEEVSASIRRDIVFAASLYTTV

P35207|S.c.Ski2p       AEGTVVRVITWLDEICREVKTASIIIGNSTLHMKMSRAQELIKRDIVFAASLYL--

P42285|H.S.SK2L2       FEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGITKIKRDIVFAASLYL--

Q9CZU3|M.M.SK2L2       FEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGITKIKRDIVFAASLYL--

Q9Y134|D.m.CG4152      FEGSIIRCMRRLEELLRQMCQASKTIGNTDLENKFSEGIRLLKRDIVFAASLYL--

P47047|S.c.Mtr4p       YEGSLIRMFKRLEELVKELVDVANTIGNSSLKEKMEAVLKLIHRDIVSAGSLYL--

Q23223|C.E.YH20        FEGSIIRTLRRLEEVLREMINAAKALANKELEQKFEDARKNLKRDIVFAASLYL--

                        ** ::: :  * *  :.:  ..  :.:  *  *:      ::**** :.***