S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Hfm1p
Mer3 / YGL251C
Hfm1
SEC3D1
Database Links
Cellular Function DNA Recombination DNA Recombination

Hfm1 Group Alignment

P51979|S.c._Hfm1p      -----------------------------------------------------MKTKFDR

A2PYH4|H.S._Hfm1       MLKSNDCLFSLENLFFEKPDEVENHPDNEKSLDWFLPPAPLISEIPDTQELEEELESHKL

                                                                               ...

 

P51979|S.c._Hfm1p      LGTGKRSRPSPNNIDFNDQSATFK------------------------------------

A2PYH4|H.S._Hfm1       LGQEKRPKMLTSNLKITNEDTNYISLTQKFQFAFPSDKYEQDDLNLEGVGNNDLPHVAGK

                       **  **.:  ..*:.:.::.:.:                                    

 

P51979|S.c._Hfm1p      --------RNKKNSRQPSFKVGLSYNSLLDDCDDENETEEIFEGRGLQFFD---------

A2PYH4|H.S._Hfm1       LTYASQKYKNHIGTEIAPEKSVPDDTKLVNFAEDKGESTSVFRKRLFKISDNIHGSAYSN

                               :*: .:. .. *   . ..*:: .:*:.*: .:*. * ::: *        

 

P51979|S.c._Hfm1p      ---------------------KDDNFSITADDTQVTSKLFDHDLEQTPDEEAK-------

A2PYH4|H.S._Hfm1       DNELDSHIGSVKIVQTEMNKGKSRNYSNSKQKFQYSANVFTANNAFSASEIGEGMFKAPS

                                            *. *:* : :. * ::::*  :   :..* .:      

 

P51979|S.c._Hfm1p      -------KPKKVTIRKSAKKCLSTTILPDSFRGVFK-FTEFNKMQSEAFPSIYESNENCI

A2PYH4|H.S._Hfm1       FSVAFQPHDIQEVTENGLGSLKAVTEIPAKFRSIFKEFPYFNYIQSKAFDDLLYTDRNFV

                              :  : . .:.  .  :.* :* .**.:** *. ** :**:** .:  ::.* :

 

P51979|S.c._Hfm1p      ISSPTGSGKTVLFELAILRLIKETNSDTNNTKIIYIAPTKSLCYEMYKNWFPSF--VNLS

A2PYH4|H.S._Hfm1       ICAPTGSGKTVVFELAITRLLMEVPLPWLNIKIVYMAPIKALCSQRFDDWKEKFGPIGLN

                       *.:********:***** **: *.     * **:*:** *:** : :.:*  .*  :.*.

 

P51979|S.c._Hfm1p      VGMLTSDTSFLETEKAKKCNIIITTPEKWDLLTRRWSDYSRLFELVKLVLVDEIHTIK-E

A2PYH4|H.S._Hfm1       CKELTGDTVMDDLFEIQHAHIIMTTPEKWDSMTRKWRDNS-LVQLVRLLLIDEVHIVKDE

                          **.** : :  : ::.:**:******* :**:* * * *.:**:*:*:**:* :* *

 

P51979|S.c._Hfm1p      KRGASLEVILTRMNTMCQN------------IRFVALSATVPNIEDLALWLKTNNELPAN

A2PYH4|H.S._Hfm1       NRGPTLEVVVSRMKTVQSVSQTLKNTSTAIPMRFVAVSATIPNAEDIAEWLSDG-ERPAV

                       :**.:***:::**:*: .             :****:***:** **:* **. . * **

 

P51979|S.c._Hfm1p      ILSFDESYRQVQLTKFVYGYSFN-CKNDFQKDAIYNSKLIEIIEKHADNRPVLIFCPTRA

A2PYH4|H.S._Hfm1       CLKMDESHRPVKLQKVVLGFPCSSNQTEFKFDLTLNYKIASVIQMYSDQKPTLVFCATRK

                        *.:***:* *:* *.* *:. .  :.:*: *   * *: .:*: ::*::*.*:**.**

 

P51979|S.c._Hfm1p      STISTAKFLLNNHIFSKSK------KRCNHNPSDKILNECMQQGIAFHHAGISLEDRTAV

A2PYH4|H.S._Hfm1       GVQQAASVLVKDAKFIMTVEQKQRLQKYAYSVRDSKLRDILKDGAAYHHAGMELSDRKVV

                       .. .:*..*:::  *  :       ::  :.  *. *.: :::* *:****:.*.**..*

 

P51979|S.c._Hfm1p      EKEFLAGSINILCSTSTLAVGVNLPAYLVIIKGTKSWNSSEIQEYSDLDVLQMIGRAGRP

A2PYH4|H.S._Hfm1       EGAFTVGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYAGGLFEEYSETDILQMIGRAGRP

                       *  * .*.: :* :*****:******:**:**.*  : .. ::***: *:**********

 

P51979|S.c._Hfm1p      QFETHGCAVIMTDSKMKQTYENLIHGTDVLESSLHLNLIEHLAAETSLETVYSIETAVNW

A2PYH4|H.S._Hfm1       QFDTTATAVIMTRLSTRDKYIQMLAYRDTVESSLHRHLIEHLNAEIVLHTITDVNIAVEW

                       **:* . *****  . ::.* :::   *.:***** :***** **  *.*: .:: **:*

 

P51979|S.c._Hfm1p      LRNTFFYVRFGKNPAAYQEVNRYVSFHSVEDSQINQFCQYLLDTLVKVKIIDISNGE-YK

A2PYH4|H.S._Hfm1       IRSTLLYIRALKNPSHYGFASGLN--KDGIEAKLQELCLKNLNDLSSLDLIKMDEGVNFK

                       :*.*::*:*  ***: *  ..     :.  :::::::*   *: * .:.:*.:.:*  :*

 

P51979|S.c._Hfm1p      STAYGNAMTRHYISFESMKQFINAKKFLSLQGILNLLATSEEFSVMRVRHNEKKLFKEIN

A2PYH4|H.S._Hfm1       PTEAGRLMAWYYITFETVKKFYTISGKETLSDLVTLIAGCKEFLDIQLRINEKKTLNTLN

                       .*  *. *: :**:**::*:* . .   :*..::.*:* .:**  :::* **** :: :*

 

P51979|S.c._Hfm1p      LSP-LLKYPFLTEKKQSQIIDRVSQKVSLLIQYELGGLEFPSYEGASKLHQTLVQDKFLV

A2PYH4|H.S._Hfm1       KDPNRITIRFPMEGR----IKTREMKVNCLIQAQLGCIPIQDFA--------LTQDTAKI

                        .*  :.  *  * :    *.  . **. *** :** : : .:         *.**.  :

 

P51979|S.c._Hfm1p      FRHCFRLLKCMVDTFIEKSD-GTSLKNTLFLLRSLNGHCWENTPMVLRQLKTIGLVSVRR

A2PYH4|H.S._Hfm1       FRHGSRITRWLSDFVAAQEKKFAVLLNSLILAKCFRCKLWENSLHVSKQLEKIGITLSNA

                       ***  *: : : * .  :..  : * *:*:* :.:. : ***:  * :**:.**:.  .

 

P51979|S.c._Hfm1p      LIRHGITNLEEMGHLSDTQIEYYLNLKIGNGIKIKNDISLLPCLNIRTKLEN-CKIENEE

A2PYH4|H.S._Hfm1       IVNAGLTSFKKIEETDARELELILNRHPPFGTQIKETVMYLPKYELKVEQITRYSDTTAE

                       ::. *:*.:::: . .  ::*  ** :   * :**: :  **  :::.:  .  .  . *

 

P51979|S.c._Hfm1p      LWLTFKVEISATFKSSIWHGQHLSLDIETEKSSGELIDFRRLQVNKLQSP--RGFRISAK

A2PYH4|H.S._Hfm1       ILVTVILRNFEQLQTKRTASDSHYVTLIIGDADNQVVYLHKITDSVLLKAGSWAKKIAVK

                       : :*. :.    :::.   .:   : :   .:..::: ::::  . * ..   . :*:.*

 

P51979|S.c._Hfm1p      ISPKLEKIEFSIHCQEIAGLGKTIVYSTDHLAS-QFSAKTPNIRKDLNSLEKCLFYESSS

A2PYH4|H.S._Hfm1       RALKSEDLSINLISSEFVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQISHSKHSDIST

                        : * *.:.:.: ..*:.**.     :. :* . :*. : .  **. ..:.:. . : *:

 

P51979|S.c._Hfm1p      DGEVGKTSRVSHKDGLEESLSSDDSILDYLNERKKSSKAVESAAVIHPEAHSSSHFSNGR

A2PYH4|H.S._Hfm1       IAGPNKGTTASKKPGNRECNHLCKSKHTCGHDCCKIGVAQKSEIKESTISSYLSDLRNRN

                        .  .* : .*:* * .*.    .*     ::  * . * :*     . :   *.: * .

 

P51979|S.c._Hfm1p      QVRSNGNYECFHSCKDKTQCRHLCCKEGIPVKYIKEKGPSSIKPVSKP------------

A2PYH4|H.S._Hfm1       AVSSVPPVKRLKIQMNKSQSVDLKEFGFTPKPSLPSISRSEYLNISELPIMEQWDQPEIY

                        * *    : ::   :*:*. .*      *   : . . *.   :*:            

 

P51979|S.c._Hfm1p      -----------------------DQIRQPLLAKNINTTPHLEKRLNSKPKQWQ-------

A2PYH4|H.S._Hfm1       GKVRQEPSEYQDKEVLNVNFELGNEVWDDFDDENLEVTSFSTDTEKTKISGFGNTLSSST

                                              ::: : :  :*::.*..  .  ::* . :       

 

P51979|S.c._Hfm1p      -------------------------EENTDIATVHTLPSKIYNLSQQMSSMEAGEQVLKS

A2PYH4|H.S._Hfm1       RGSKLPLQESKSKFQREMSNSFVSSHEMSDISLSNSAMPKFSASSMTKLPQQAGNAVIVH

                                                .* :**:  ::  .*:   *    . :**: *: 

 

P51979|S.c._Hfm1p      GPENCPEIIPIDLESSDSYSSNTAASSISDPNGDLDFLGSDIEFE---------------

A2PYH4|H.S._Hfm1       FQERKPQNLSPEIEKQCFTFSEKNPNSSNYKKVDFFIRNSECKKEVDFSMYHPDDEADEM

                         *. *: :. ::*..    *:. ..* .  : *: : .*: : *              

 

P51979|S.c._Hfm1p      -----------

A2PYH4|H.S._Hfm1       KSLLGIFDGIF