S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein
Y55B1AL.3 CG7972 Hel308
Hel308
Database Links
Cellular Function
  • DNA repair
  • DNA recombination

Group Alignment

sp|Q8TDG4|HEL308_H.S.      -----------VEVQP------LLLSDSPECLVLGGGDTNPDLLRHMPTD

sp|Q2VPA6|HEL308_M.m.      MEDGCPRIRRRVSVRKRNRGNLENLRASPTPAELQPAEDTEDEAAAGSRR

tr|Q9VSE2|HEL308_D.m.      ---------------------------------LFGTQATTSTNKMTQSG

tr|Q9N389|HEL308_C.E.      --------------------------------------------------

                                                                            

 

sp|Q8TDG4|HEL308_H.S.      RGVGD----QPNDSEVDMFGDYDSFTENSFIAQVDDLEQKYMQLPEHKKH

sp|Q2VPA6|HEL308_M.m.      RKTGSPEHAQENDSEEDMFGDYDSFTESSFLAHVDDLEQRYMQLPECGDR

tr|Q9VSE2|HEL308_D.m.      -----------SDDGLGLFADTS-------FPSAQSVPPNSASKPDEASA

tr|Q9N389|HEL308_C.E.      -----------------------------------------MNRTPIRRC

                                                                     . .    

 

sp|Q8TDG4|HEL308_H.S.      ATDFATENLCSESIKNKLSITTIGNLTELQTDKHTENQSGYEG-VTIEPG

sp|Q2VPA6|HEL308_M.m.      DADSGTKDLCSAGLKNNLRVTTVINLTDPETSEHGQKQSHLDVPAEPEPG

tr|Q9VSE2|HEL308_D.m.      PTDKHQIDLADE--ENADKLFKKINLNDLSIAEMEDIFHGADDFSDPMVQ

tr|Q9N389|HEL308_C.E.      KSAEIEEDPFSPIPKFSRLRTPRTSREYVCPLKSTSPQSPSSSTENEPPP

                            :     :  .   :         .       :  .     .       

 

sp|Q8TDG4|HEL308_H.S.      ADLLYDVPSSQAIYFENLQNSSNDLGDHSMKERDWKSSSHNTVNEELPHN

sp|Q2VPA6|HEL308_M.m.      SDLSFDVPSSQILYFENPQNSPEALGDPCTKKT--NGDPQKSSHEELVSS

tr|Q9VSE2|HEL308_D.m.      NTQLF----LDAMTFKKPK-TPEKLLAPLKDDS--MSFISKSVIEGLVQG

tr|Q9N389|HEL308_C.E.      VSVTSPPARKRALEESTVTPIQQKIGPPVLKRS---------SLSKLADG

                                       :  ..     : :     .             . *  .

 

sp|Q8TDG4|HEL308_H.S.      CIEQPQQNDESSSKVRTSSDMNRRKSIKDHLKNAMTGNAKAQTPIFSRSK

sp|Q2VPA6|HEL308_M.m.      HTEQPEPNNDFSN-VRAASESSRRKSLKDHLKSTMAGNARAQTPAFPRSK

tr|Q9VSE2|HEL308_D.m.      TQ-------------YVTCEELKNQSLLDPVN------------------

tr|Q9N389|HEL308_C.E.      FR-------------TAAYLNNESENDDDPFG-----------------L

                                           .:    . :.  * .                  

 

sp|Q8TDG4|HEL308_H.S.      QLKDTLLSEEINVAKKTIESSSNDLGPFYSLPSKVRDLYAQFKGIEKLYE

sp|Q2VPA6|HEL308_M.m.      HLREALLSEEISVAKKAIESPSDDLGPFYSLPSKVRDLYVQLKGIKKLYD

tr|Q9VSE2|HEL308_D.m.      --WETQAFADFEKNNQDIDKFPS-KGEFYGLPDKVKKMILEHKGINSLYE

tr|Q9N389|HEL308_C.E.      SFRNEQVLMSKCAPAPEKRPETLTLDPSKCLPERDMEMYRKIKKLDKFYD

                              :     .           .   .    **.:  .:  : * :..:*:

 

sp|Q8TDG4|HEL308_H.S.      WQHTCLTLNSVQERKNLIYSLPTSGGKTLVAEILMLQELLCCRKDVLMIL

sp|Q2VPA6|HEL308_M.m.      WQHTCLTLRSVQERKNLIYSLPTSGGKTLVAEILMLQELLCRQKDVLMIL

tr|Q9VSE2|HEL308_D.m.      WQDECLNLPAIRQRKNLIYALPTSGGKTLVAEILMLRELLCRERNVLFIL

tr|Q9N389|HEL308_C.E.      WQQECLSDKRLLDGENCILSLPTGAGKTLIAEVLMLREAIVRKRNAILVL

                           **. **.   : : :* * :***..****:**:***:* :  .::.:::*

 

sp|Q8TDG4|HEL308_H.S.      PYVAIVQEKISGLSSFGIELGFFVEEYAGSKGRFPPTKRREKKSLYIATI

sp|Q2VPA6|HEL308_M.m.      PYVAIVQEKISSLSSFGIELGFFVEEYAGSKGRFPPIKRREKKSLYIATI

tr|Q9VSE2|HEL308_D.m.      PYVSIVQEKVSAMSPFAIDLDFIVEEYTAGKGKCPPQPRRKRRSLFIASI

tr|Q9N389|HEL308_C.E.      PYVAIVQEKISALAPFEDAFGINIEEYASNKGRFPPIKRRKRVSVYVATI

                           ***:*****:*.::.*   :.: :***:..**: **  **:: *:::*:*

 

sp|Q8TDG4|HEL308_H.S.      EKGHSLVNSLIETGRIDSLGLVVVDELHMIGEGSRGATLEMTLAKILYTS

sp|Q2VPA6|HEL308_M.m.      EKAHSLVNALIETSRLSTLGLVVVDELHMIGEGSRGAILEMTLAKVLYTS

tr|Q9VSE2|HEL308_D.m.      EKGAVLMDSLIDVQRPHEIGLVVVDELHLIGEKGRGATLEAFLTKVMFLN

tr|Q9N389|HEL308_C.E.      EKANMLINSLITQGQLDRVGMVVVDELHMIGDGGRGAILEQLLAKFLYKG

                           **.  *:::**   :   :*:*******:**: .*** **  *:*.:: .

 

sp|Q8TDG4|HEL308_H.S.      KTTQIIGMSATLNNVEDLQKFLQAEYYTSQFRPVELKEYLKINDTIYEVD

sp|Q2VPA6|HEL308_M.m.      KTTQIIGMSATLNNVEDLQAFLKAEYYTSQFRPVELKEFLKVNDTIYEVD

tr|Q9VSE2|HEL308_D.m.      ANIQIVGMSATIGNLSEISSFLNADVYTRGFRPVELKEYIKCGPDLLEIN

tr|Q9N389|HEL308_C.E.      -TGQIVGMSATLPNIDDLKFALRAFVYSTNFRPVELTEFVKIGQTMHQVS

                            . **:*****: *:.::.  *.*  *:  ******.*::* .  : ::.

 

sp|Q8TDG4|HEL308_H.S.      SK---AENGMTFSRLLNYKYSDTLKKMDPDHLVALVTEVIPNYSCLVFCP

sp|Q2VPA6|HEL308_M.m.      SQ---AADGMTFSRLLSYKYSEALKKMDPDRLVALVTEVIPNYSCLVFCP

tr|Q9VSE2|HEL308_D.m.      SAGQTLEEIFVPSRSVEYNYSEAVKRADPDHLAGLISECAPEHCCLVFCP

tr|Q9N389|HEL308_C.E.      EN--------GDLNPAGDLPTNNLKSTDPDGICQLLAKLIPKNSAVIFCP

                           .            .      :: :*  *** :  *:::  *: ..::***

 

sp|Q8TDG4|HEL308_H.S.      SKKNCENVAEMICKFLSK-EYLKHKEKEKCEVIKNLKNIGNGNLCPVLKR

sp|Q2VPA6|HEL308_M.m.      SKKNCENVAEMLCKFLSK-DYLNHREKEKCEVIKSLRNIGNGKVCPVLKR

tr|Q9VSE2|HEL308_D.m.      SRKNCENVALLLSRIVPKHKFFEHRRSEKLDLMDALDKMC-GILSPVLAK

tr|Q9N389|HEL308_C.E.      NKKNCENVAVLIAKTLPAHIRQAKRAESDAFLQSYLSDNDDERMDAVLKQ

                           .:******* ::.: :.      :: ...  : . * .     : .** :

 

sp|Q8TDG4|HEL308_H.S.      TIPFGVAYHHSGLTSDERKLLEEAYSTGVLCLFTCTSTLAAGVNLPARRV

sp|Q2VPA6|HEL308_M.m.      TVPFGIAYHHSGLTSEERKLLEEAYSTGVLCLLTCTSTLAAGVNLPARRV

tr|Q9VSE2|HEL308_D.m.      TLPYGIAYHHSGLTTDERKYIETAYRFGVVTVICCTSTLAAGVNLPAKRV

tr|Q9N389|HEL308_C.E.      CILSGVAYHHSGLTQDERKCVEAAFMEGLIYVVCATSTLAAGVNLPVRRV

                            :  *:******** :*** :* *:  *:: :. .***********.:**

 

sp|Q8TDG4|HEL308_H.S.      ILRAPYVAKEFLKRNQYKQMIGRAGRAGIDTIGESILILQE-KDKQQVLE

sp|Q2VPA6|HEL308_M.m.      ILRAPYVANTFLKRNQYKQMVGRAGRAGIDTAGESILLLQE-KDKQQVLE

tr|Q9VSE2|HEL308_D.m.      IIRAPYVGQEFLTLCKYKQMVGRAGRAGLGEAGESILIAQS-KDNLLVGQ

tr|Q9N389|HEL308_C.E.      IIKAPMVGRERLGKAQYLQMAGRAGRAGFDTKGDCITIIKAGEEERWFRE

                           *::** *..  *   :* ** *******:.  *:.* : :  :::  . :

 

sp|Q8TDG4|HEL308_H.S.      LITKPLENCYSHLVQEFTKGIQTLFLSLIGLKIATNLDDIYHFMNGTFFG

sp|Q2VPA6|HEL308_M.m.      LISGPLETCCSHLVEEFTKGIQALFLSLIGLKIAASLGDIYQFMSGTFFG

tr|Q9VSE2|HEL308_D.m.      MLFSPMDKALSSLDQNEAVGLQSLILSVVGLNLAECRRDLNRLVNSTLLS

tr|Q9N389|HEL308_C.E.      MLKSDIPRCMSSLSSE--ESMGSFILDCVVLKLAENIEEIMTAVRYSLFY

                           ::   :  . * * .:   .: :::*. : *::*    ::   :  :::

 

sp|Q8TDG4|HEL308_H.S.      VQQK---------VLLKEKSLWEITVESLRYLTEKGLLQKDTIYKSEEEV

sp|Q2VPA6|HEL308_M.m.      VQQK---------ILLKEKSLWEITVDALEHLTEKGLLQKDSCGDNEG-L

tr|Q9VSE2|HEL308_D.m.      VQAKSLEVAVNEIVLRILREMFKNKVLQLAEPQAKSKINSSDIITSQDVS

tr|Q9N389|HEL308_C.E.      AQES----------PENIRKLVESSVKRLEEHYFITIEPLEQDVASEPSA

                           .* .              :.: : .*  *           .    .:  

 

sp|Q8TDG4|HEL308_H.S.      QYN---------------FHITKLGRASFKGTIDLAYCDILYRDLKKGLE

sp|Q2VPA6|HEL308_M.m.      ECH---------------FRITKLGQASFKGAIDLAYCDTLYRDLKKGLE

tr|Q9VSE2|HEL308_D.m.      QANRPAGDRRLLIGQSTPFKLTNIGRAAFKAGIDYKRANAIHKELKQAQQ

tr|Q9N389|HEL308_C.E.      QASSIPRVPG-------KISPSDLGNAVFNAGFDPDEATRLHADLVSSLN

                           :                 :  :.:*.* *:. :*   .  :: :* .. :

 

sp|Q8TDG4|HEL308_H.S.      G-LVLESLLHLIYLTTPYDLVSQCN----PDWMIYFRQFSQLSPAEQNVA

sp|Q2VPA6|HEL308_M.m.      G-LVLESLLHLIYLTTPYDLAAQSE----PDWMVYFKQFGQLSPTEQNVA

tr|Q9VSE2|HEL308_D.m.      Q-LILTNYLHLLYLVVCFNSNERGDELFPADASILFGVYTSLPLDSQAMF

tr|Q9N389|HEL308_C.E.      QGVIFASHFHLLFIITPYEQVCNIN------WDLFLLMYNALPSSERKLL

                             ::: . :**::: . ::   . :        : :  :  *.  .: :

 

sp|Q8TDG4|HEL308_H.S.      AILGVSESFIGKKASGQAIGKKVDKNVVNRLYLSFVLYTLLKETNIWTVS

sp|Q2VPA6|HEL308_M.m.      ALLGVSESFIGKKAAGQAVRKKVDKNVVNRLYLSFVLYSLLKETNVWSVS

tr|Q9VSE2|HEL308_D.m.      KQLGFTEAHAARLFKTQSVQGPLS-LQLNRLYKVLILADILNLLPIPSVA

tr|Q9N389|HEL308_C.E.      AECGLEEKFILEAIITR--VDLTAGTPRMRLYIALMLQKIWNHEPMYTVA

                              *. * .  .    :            ***  ::*  : :   : :*:

 

sp|Q8TDG4|HEL308_H.S.      EKFNMPRGYIQNLLTGTASFSSCVLHFCEELEEFWVYRALLVELTKKLTY

sp|Q2VPA6|HEL308_M.m.      EKFNLPRGYIQNLLMGAASFSSCVLHFCEELEEFWVYKALLVELTKKLTY

tr|Q9VSE2|HEL308_D.m.      SKYNVERGTLQHLISQSTAAASAIVRLCEELEEFWCYKPLFERILHKMDR

tr|Q9N389|HEL308_C.E.      ERFGVEKGWLQATLQSSISQAASIAKFSEKITTMWPLRKLLPELVQRLSE

                           .::.: :* :*  :  : : ::.: ::.*::  :*  : *: .: ::: 

 

sp|Q8TDG4|HEL308_H.S.      CVKAELIPLMEVTGVLEGRAKQLYSAGYKSLMHLANANPEVLVRTIDHLS

sp|Q2VPA6|HEL308_M.m.      CVKAELIPLMEVTGVLEGRAKQLYNAGYRSIMHLANANPEVLVKTIDHLS

tr|Q9VSE2|HEL308_D.m.      CGTFELEPLMELPAVKINRARQLYAAGFQTIGDIARVRPSHLVQSLEHMP

tr|Q9N389|HEL308_C.E.      AAQPELLPLMTVDGIKKARAAILFKAGYKTVGMIARANPLKLVQELGTIR

                           .   ** *** : .:   **  *: **::::  :*...*  **: :  :

 

sp|Q8TDG4|HEL308_H.S.      RRQAKQIVSSAKMLLHEKAEALQEEVEELLRLPSDFPGAVASSTDKA---

sp|Q2VPA6|HEL308_M.m.      RRQARQIVSSAKMLLHEKAEALQGEAEELLRLPADLPGLGGPSSERAGSH

tr|Q9VSE2|HEL308_D.m.      LRVATEIVSAAKIILMKKLDHLEEETENLK--------DCLKTSDKN---

tr|Q9N389|HEL308_C.E.      MAQANSIIASARMVLRDQVDEKMEELDVWG--------VATDSFNYF---

                              * .*:::*:::* .: :    * :               : :    

 

sp|Q8TDG4|HEL308_H.S.      -------

sp|Q2VPA6|HEL308_M.m.      AGDVTLS

tr|Q9VSE2|HEL308_D.m.      -------

tr|Q9N389|HEL308_C.E.      -------