S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein
C28H8.3 DHX60
DHX60
Database Links
Cellular Function

Group Alignment

sp|Q8IY21|DHX60_H.S.                --------------------------------------------------

tr|Q811K8|DHX60_M.m._Fragment_      ----------------MEKEYTGFLEIMSHLILETMSKADYSSLFNDFVE

sp|Q09475|YP93_C.E.                 DASSVMSDDLESLGETTEVLNFSLEQLSMMKKNLAQFPCSYKNIISEFAD

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                ----------------------------NLHFFYLVERYLVDLISKGGQF

tr|Q811K8|DHX60_M.m._Fragment_      SEFFLIDGDSLLITCVCERSL---KPGQSLHFFYLVERYLLDVISKGGQF

sp|Q09475|YP93_C.E.                 VEIFLISIDSLIVECAAHSYHNWDVAGQSMVLNKQIDRFLQQFVDIGGRF

                                                                .: :   ::*:* :.:. **:*

 

sp|Q8IY21|DHX60_H.S.                TIVFFKDAEYAYFNFPELLSLRTALILHLQKNTTIDVRTTFSRCLSKEWG

tr|Q811K8|DHX60_M.m._Fragment_      AIVFFKDAEYAYFNVPELLTLRTALILHLQKNTTIEVWTKFSNCLSEEWN

sp|Q09475|YP93_C.E.                 KLVVFSDLTTQFAKDTTLSFARSTALAHLANGPHARDLLFFTNPTDPEWD

                                     :*.*.*    : : . *   *:: : ** :..       *:.  . **.

 

sp|Q8IY21|DHX60_H.S.                SFLEESYPYFLIVADEGLNDLQTQLFNFLIIHSWARKVNVVLSSGQESDV

tr|Q811K8|DHX60_M.m._Fragment_      ICLGQSCPYFLILADEGLNDLQTHLFNFVVIQAWAAKVNIVLFSGQTSDI

sp|Q09475|YP93_C.E.                 KLLNDLTPSFLMISTDNVTQNVCASQEIDLTKQFETIAFDVLTRSMS--V

                                      * :  * **::: :.:.:      :: : : :   .  **  .    :

 

sp|Q8IY21|DHX60_H.S.                LCLYAYLLPSMYRHQIFSWKNKQNIKDAYTTLLNQLERFKLSALAPLFGS

tr|Q811K8|DHX60_M.m._Fragment_      LRLYAYFMQSSHVMQMFFKEEKRRIMIVYKSLIQQLEKYRDMALAHLFGD

sp|Q09475|YP93_C.E.                 VLLHSIKVNFVSVEAYYIQPLLVVAPDWQAFLAAHWDNNGTLLRNHLSKE

                                    : *::  :        :              *  : :.        *  .

 

sp|Q8IY21|DHX60_H.S.                LKWNNITEEAHKTVSLLTQVWPEGS-----DIRRVFCVTSCSLSLRMYHR

tr|Q811K8|DHX60_M.m._Fragment_      LKFNDMEEKVCETVSLLKQLWPEGS-----DIRRVFCVTSCSLFLEMYHC

sp|Q09475|YP93_C.E.                 IKFNQFETPADLWVKVITDAKATGKGSDTFDTLAAAVILSSLICSRRGAH

                                    :*:*::   .   *.::.:  . *.     *   .  : *. :  .   

 

sp|Q8IY21|DHX60_H.S.                FLGNREP-SSGQETEIQQVNSNCLTLQEMEDLCKLHCLTVVFLLHLPLSQ

tr|Q811K8|DHX60_M.m._Fragment_      YLESREKGASEEMSKVKQKTDNCLTLKDMEDFCKLHCLSVALLLHVPLSQ

sp|Q09475|YP93_C.E.                 RIYYPTRTDAKRGLNVIRDRRLILNAAVVLLDKADHANSKLDLSDLWDGR

                                     :       : .  :: :     *.   :      *. :   * .:  .:

 

sp|Q8IY21|DHX60_H.S.                RACARVITSHWAEDMKPLLQMKKWCEYFILR--NIHTFEFWNLNLIHLSD

tr|Q811K8|DHX60_M.m._Fragment_      RARSRFITANWIQDLKTVLKMKKWCEYFILS--NLDMFESWSLNLLHLSG

sp|Q09475|YP93_C.E.                 MVYSIFDELSANETVLPYRLQDDFAKYHQKAGLTVPLATDTNEKLFDPIP

                                     . : .      : : .    ..:.:*.     .:      . :*:.  

 

sp|Q8IY21|DHX60_H.S.                LNDELLLKNIAFYYENENVKGLHLNLGDTIMKDYEYLWNTVSKLVRDFEV

tr|Q811K8|DHX60_M.m._Fragment_      LSDEPLLRNIAFYYENENKEGLDLNVGDAIMNEYVHLWDTVSKLVRKFDV

sp|Q09475|YP93_C.E.                 EITDPLVDLPILYSVTSPMIKRFVPEIEKMTSQNAVEEGTVQDYADYLKD

                                       : *:    :*  ..      :   : : .:     .**.. .  :.

 

sp|Q8IY21|DHX60_H.S.                GQPFPLRTTKVCFLGKK-----PSPIKDSSNEMVPNLGFIPTSSFVVDKF

tr|Q811K8|DHX60_M.m._Fragment_      GKPIPLRTTKVHFLEKT-----PSPIKESSQEMMPNLGFIPMSCNLVDEF

sp|Q09475|YP93_C.E.                 TSQWRLKPIEETYAQKEEKIEDAWQLKKANRSKQFLMRWYELFANSLEGR

                                     .   *:. :  :  *      .  :*.:...    : :    .  :: 

 

sp|Q8IY21|DHX60_H.S.                AGDILKDLPFLKSDDPIVTSLVKQKEFDELVHWHSHKPLSDDYDRSRCQF

tr|Q811K8|DHX60_M.m._Fragment_      TGDILKDLPFLTSDDPIVTSLVKHKEFDELVHWHSHRPLSDDYDRTKVNS

sp|Q09475|YP93_C.E.                 GSNLLVDFSRVPKGYAVVEEEVTDEKKTGKGGWSGQKQQKPGAGGKKGAT

                                     .::* *:. : .. .:* . *..::      * .::  . . . .:  

 

sp|Q8IY21|DHX60_H.S.                DEKSRDPRVLRSVQKYHVFQRFYGNSLETVSSKIIVTQTIKSKKDFSGPK

tr|Q811K8|DHX60_M.m._Fragment_      GDR-RDPNHLKSLQKYHSFQRFYGESLESVTSKTITTQGPKPKKDCIKSK

sp|Q09475|YP93_C.E.                 KESGKSKKDLILEANKKAKDQKVAESEKVKIKYGCQQGKESVIFLNNLYS

                                     :  :. . *    : :  ::  .:* :   .        .        .

 

sp|Q8IY21|DHX60_H.S.                SKKAHETKAEIIARENKKRLFAREEQKEEQKWNALSFSIEEQLKENLHSG

tr|Q811K8|DHX60_M.m._Fragment_      STKAHETKAEIIKKKKKK--------------------------------

sp|Q09475|YP93_C.E.                 SLDLPETRALCVYEIAVREGRTIFDQHQG---------------------

                                    * .  **:*  : .   :                               

 

sp|Q8IY21|DHX60_H.S.                IKSLEDFLKSCKSSCVKLQVEMVGLTACLKAWKEHCRSEEGKTTKDLSIA

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 ---------------------------------------TDKQEVRRNAA

                                                                                      

 

sp|Q8IY21|DHX60_H.S.                VQVMKRIHSLMEKYSELLQEDDRQLIARCLKYLGFDELASSLHPAQDAEN

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 IDLVGHLKDCFVKHWDHLESKQKEQIVDLWVSLGFEAPAGSKPSSEAKQ-

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                DVKVKKRNKYSVGIGPARFQLQYMGHYLIRDERKDPDPRVQDFIPDTWQR

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 -------KKLNLGINMVYYQLQYGGELIDIQSDPKKDDRVSGFAPDGWQR

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                ELLDVVDKNESAVIVAPTSSGKTYASYYCMEKVLKESDDGVVVYVAPTKA

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 KMLDSVDRGNSALIIAPTSAGKTFVSYYCIEKVLRSSDNDVVVYVAPSKA

                                                                                      

 

sp|Q8IY21|DHX60_H.S.                LVNQVAATVQNRFTKN-LPSGEVLCGVFTREYRHDALNCQVLITVPACFE

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 LINQVCGSVYARFRNKSMKRGISLFGTLTQEYSQNAMQCQVLITVPECLQ

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                ILLLA--PHRQNWVKKIRYVIFDEVHCLGGEIGAEIWEHLLVMIRCPFLA

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 ELMLSRTPAVQKFVSHIKYVVFDEVHSIGASEESHIWEQLLLLIQCPFLA

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                LSATISNPEHLTEWLQSVKWYWKQEDKIIENNTASKRHVGRQAGFPKDYL

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 LSATIGNANKLHEWLNSS-----------EQAKSAGKRKVELINYGERYS

                                                                                      

 

sp|Q8IY21|DHX60_H.S.                QVKQSYKVRLVLYGERYNDLEKHVCSIKHGDIHFDHFHPCAALTTDHIER

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 ELELSILNINDPHGE-----DDGAVHKKAGERAVIPLMPYGVYMPEKLRM

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                YGFPPDLTLSPRESIQLYDAMFQIWKSWPRAQELCPENFIHFNNKLVIKK

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 FSIPEDQQLTARQVLHLYNMMAEVDDATKKEFEPCKFFGQHGTKAVWISR

                                                                                      

 

sp|Q8IY21|DHX60_H.S.                MDARKYEESLKAELTSWIKNGNVEQARMVLQNLSPEADLSPENMITMFP-

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 SELRRLENALKERFMEWLSSDEQKINSILKILKEPVNTQLSYRARPFNKE

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                --------LLVEKLRKMEKLPALFFLFKLGAVENAAESVSTFLKKKQETK

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 KIANDYIVTLVDDLKEKGELPAICFNDDRHVCEKLAVTLANELERRELEY

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                RPPKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEH

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 METDEFKNKYMIKDESKLVKLAKRKRDDAEKKKKGDKDEDAGPEKDDDEM

                                                                                      

 

sp|Q8IY21|DHX60_H.S.                DNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRVKFERKGEE----L

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 DVLAMKKAKLARALERFKLRGRNGGDPDIYAKMVERMQKGAKTRESTQVL

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                KALAERGIGYHHSAMSFKEKQLVEILFRKGYLRVVTATGTLALGVNMPCK

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 LKLFERGIGYHHAGLNTVERGAVEVLFRSGNLAVLFSTSTLSLGVNMPCK

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                SVVFAQNSVYLDALNYRQMSGRAGRRGQDLMGDVYFFDIPFPKIGKLIKS

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 TVMFGVDTLQLTPLLYRQMSGRAGRRGFDHSGNVIFMSIPTSKVRRLLTA

                                                                                      

 

sp|Q8IY21|DHX60_H.S.                NVPELRGHFPLSITLVLRLMLLASKGDDPEDTKAKVLSVLK---------

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 SLSNLQGNPPFTVLFLLRLFAYVHQQDILNEEGQKVSTMKQRAFAAKSLL

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                ------HSLLSFKQPRVMDMLKLYFLFSLQFLVKEGYLDQEGNPMGFAGL

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 EHSFSIHTRREAQDGILQKQLRMFSAFSFQLLRHLQLLSPFGEGKNFAEM

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                VSHLHYHEPSNLVFVSFLVNGLFHDLCQPTRKGSKHFSQDVMEKLVLVLA

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 AIHSSSGANGTLLFIYLMQKKCFHQLIKSYDTAEQAQLG-----ILEVLA

                                                                                      

 

sp|Q8IY21|DHX60_H.S.                HLFGRRYFPPKFQDAHFEFYQSKVFLDDLPEDFSDALDEYNMKIMEDFTT

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 NLFTNLRMTP-FHERSDNLENVQVTLRGLPSLLKPYVEEYNSTVTGLYKR

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                FLRIVSKLADMNQEYQLPLSKIKFTGKECEDSQLVSHLMSCKEGRVAISP

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 FMAASSQDGNLFDPSFAVSGKLDSESVSLTEDFLVAPLFDQYSHDESFLP

                                                                                      

 

sp|Q8IY21|DHX60_H.S.                FVCLSGNFDDDLLRLETPNHVTLGTIGVNRSQAPVLLSQKFDNRGRKMSL

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 VIDFN----------------------------------KKDHRGRKIQR

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                NAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSISVSLRELCE

tr|Q811K8|DHX60_M.m._Fragment_      --------------------------------------------------

sp|Q09475|YP93_C.E.                 NAFAYDFYVHGSRNMLMDVNGLHVSVAWFLLHDFAAILERLAIGVHNMAR

                                                                                     

 

sp|Q8IY21|DHX60_H.S.                NEDDNVVLAFEQLSTTFWEKLNKV-------

tr|Q811K8|DHX60_M.m._Fragment_      -------------------------------

sp|Q09475|YP93_C.E.                 PQDP-LVLVLEELHKNYDEKFRKAFGMRTRD