S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Slh1p
YGR271W
Y54E2A.6 CG5205 ASCC3
ASCC3
HELC1
Database Links
Cellular Function pre-mRNA splicing pre-mRNA splicing

S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Brr2p
YER172C
Y46G5A.4 CG5931 ASCC3L1
ASCC3L1
U5-200KD
Database Links
Cellular Function
  • Transcription
  • Translation

Group Alignment

Q8N3C0|H.S.HelC1          ---------MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKII

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      --------MWEPPRLSASLRAKTELEARSRRLNVLR--QARTTSAASTTTNSQNKEEQTI

Q9XWI5|C.E.Q9XWI5         ------------------------------------------------------------

P53327|S.C.Slh1p          ------------------------------------------------------------

O75643|H.S.U5-200KD       ------MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVG-KLEGTRMG

Q6P4T2|M.M.Ascc3l1        ------MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVG-KLEGTRMG

Q9VUV9|D.m.Brr2           ------MADAAARQLQYEYKANSNLVLQADVRLIERPRRDEATGEVCSLVG-KLDGTRMG

Q9U2G0|C.E.Brr2           ------MADELARIQQYEYRQNSNLVLSVDYNLTDRRGREEPTGEVLPITDKEMRKMKMG

P32639|S.c.Brr2p          MTEHETKDKAKKIREIYRYDEMSNKVLKVDKRFMNTSQNPQRDAEISQPKSMSGRISAKD

                                                                                     

 

Q8N3C0|H.S.HelC1          KFLNEKLEKSKMQSINEDLKDILHAAKQIVGTDNGREAIESGAAFLFMTFHLKDSVGHKE

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      ARLLAQMPTEKQPAAKVQLQKLRNLVQECMGYEEQPQVVEHAALFLFWLLLDQRVLLVAT

Q9XWI5|C.E.Q9XWI5         ------------------------------------------------------------

P53327|S.C.Slh1p          --MSTEYSADSSKSFMIAMQSMIDTSQTFN------------------------------

O75643|H.S.U5-200KD       DKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETY

Q6P4T2|M.M.Ascc3l1        DKAQRTKPQMQEERRAKRRKRDEDRHDMNKMKGYTLLSEGIDEMVGIIYKPKTKETRETY

Q9VUV9|D.m.Brr2           DRYQRTKPEKTEERKVKRQKRDEAQYDFERMKGATLLSEGIDEMVGIVYRPKTQETRQTY

Q9U2G0|C.E.Brr2           DRAIKGKAPVQDQKKKRKKKDDEK----AQQFGRNVLVDNNELMG--AYKPRTQETKQTY

P32639|S.c.Brr2p          MGQGLCNNINKGLKENDVAVEKTGKSASLKKIQQHNTILNSSSDFRLHYYPKDPSNVETY

                                                                                     

 

Q8N3C0|H.S.HelC1          TKAIKQMFGPFPSSSATAACN--ATNRIISHFSQDDLTALVQMTEKEHGDRVFFGKNLAF

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      TQRLHGMFGQTFDRKKTQIHD--CVQAIGDLLEDHERSALKRWRQTHHKVPGVGPLWGAH

Q9XWI5|C.E.Q9XWI5         ------------------------------------------------------------

P53327|S.C.Slh1p          -----------LDRSKISLPD--FDDELKKVQKDEPN-----------------------

O75643|H.S.U5-200KD       EVLLSFIQAALGDQPRDILCG--AADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHV

Q6P4T2|M.M.Ascc3l1        EVLLSFIQAALGDQPRDILCG--AADEVLAVLKNEKLRDKERRREIDLLLGQTDDTRYHV

Q9VUV9|D.m.Brr2           EVLLSFIQEALGDQPRDILCG--AADEILAVLKNDRLKDRERKKDIDSLLGAVTDERFAL

Q9U2G0|C.E.Brr2           EVILSFILDALGDVPREVLCG--AADEVLLTLKNDKFRDKEKKKEVEALLGPLTDDRIAV

P32639|S.c.Brr2p          EQILQWVTEVLGNDIPHDLIIGTADIFIRQLKENEENEDGNIEERKEKIQHELGINIDSL

                                                                                     

 

Q8N3C0|H.S.HelC1          SFDMHDLDHFDELPING------ETQKTISLDYKKFLNEHLQEACTPELKPVEKTNGSFL

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      IHVKCTPSEWMDISLLT------DLAPDALLKNRTVNKFSMKHTTKAAPVASTSSEAAKL

Q9XWI5|C.E.Q9XWI5         ------------------------------------------------------------

P53327|S.C.Slh1p          -----QRTELTVLSQDR------NDWDDIFEEFKDISFAQLQSIIDSYKTKNAVAVYKKI

O75643|H.S.U5-200KD       LVNLGKKITDYGGDKE-----IQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASD

Q6P4T2|M.M.Ascc3l1        LVNLGKKITDYGGDKE-----IQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASD

Q9VUV9|D.m.Brr2           LVNLGKKITDFGSDAVNALTAAPNNEEQIDETYGINVQFEESEEESDNDMYGEIRDDDAQ

Q9U2G0|C.E.Brr2           LINLSKKISDFSIEEEN----KPEGDGDIYENEGVNVQFDSDEEEDDGGMVNEIKGDSEE

P32639|S.c.Brr2p          KFNELVKLMKNITDYETHPDNSNKQAVAILADDEKSDEEEVTEMSNNANVLGGEINDNED

                                                                                      

 

Q8N3C0|H.S.HelC1          WCEVEKYLNSTLKEMTEVPRVEDLCCTLYDMLASIKSGDELQDELFELLGPEGLELIEKL

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      SPELQ-----TLLEISAKLDDEHLIIRVGDILGSQRSSEVLQNELMEILGFDYFELVEKL

Q9XWI5|C.E.Q9XWI5         ------------------------------------------------------------

P53327|S.C.Slh1p          G---------KLINEAETTLSSNVLLETVLQMVYKHQKQELEKELLDFLGTGNIDLVSLL

O75643|H.S.U5-200KD       DDMEGDEAVVRCTLSANLVASGELMSSKKKD---LHPRDIDAFWLQRQLSRFYDDAIVSQ

Q6P4T2|M.M.Ascc3l1        DDMEGDEAVVRCTLSANLVASGELMSSKKKD---LHPRDIDAFWLQRQLSRFYDDAIVSQ

Q9VUV9|D.m.Brr2           D--EGEEARIDHTLHAENLANEEAANNVKKER-SLHPLDIDAYWLQRCLSKFYKDAMVSQ

Q9U2G0|C.E.Brr2           E--SEEEEGVDTDYTATLKGDGHLTEDEQKARGILHPRDIDAHWIQRSLAKYFKDPLIAQ

P32639|S.c.Brr2p          DDEEYDYNDVEVNSKKKNKRALPNIENDIIKLSDSKTSNIESVPIYSIDEFFLQRKLRSE

                                                                                     

 

Q8N3C0|H.S.HelC1          LQNRITIVDRFLNSSNDHR-----FQALQDNCKKILGENAKPNYGCQVTIQSEQEKQLMK

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      LMERDKIARQLDQFATRSRRVMEVKQKRMEAAASGGAAERRPTVASAVVVQSAQEKQLSK

Q9XWI5|C.E.Q9XWI5         ------------------------------------------------------------

P53327|S.C.Slh1p          LQHRRMIVAT-------------------------------PIETTILLIKNAVNSTPEF

O75643|H.S.U5-200KD       KKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEK

Q6P4T2|M.M.Ascc3l1        KKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEPEK

Q9VUV9|D.m.Brr2           SKAADVLKILKDAADDRDCENQLVLLLGYDCFDFIKQLKLNRQMVLYCTMLASAQTDSER

Q9U2G0|C.E.Brr2           QKQTEVIGILKNAADDRDAENQLVLLLGFDQFEFIKCLRQNRLMILYCTLLRQAN-EKER

P32639|S.c.Brr2p          LGYKDTSVIQDLSEKILNDIETLEHNPVALEQKLVDLLKFENISLAEFILKNRSTIFWGI

                                                                                     

 

Q8N3C0|H.S.HelC1          QYRREEKRIARREKKAGEDLEVSEG--LMCFDPKELRIQREQALLNARS-VPILSRQRDA

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      MQRREEKKLQRIMRSIKDEEAEDDPNCAVAVSVQQLRMQHQRKLLEAAQREPLLLSTKAA

Q9XWI5|C.E.Q9XWI5         -------------------------------------MKWKPSLVAGGPRIEEI------

P53327|S.C.Slh1p          LTQQDIRN-------------------------QVLESAEDAKNRKLNPATKIIK-----

O75643|H.S.U5-200KD       ERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGE--

Q6P4T2|M.M.Ascc3l1        ERIVGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGE--

Q9VUV9|D.m.Brr2           QRIREKMRGNSALAKILRQLDTGKSEDQEEGEARGSKRGKG-----DAEDGGAAAAGQ--

Q9U2G0|C.E.Brr2           LQIEDDMRSRPELHPILALLQETDEGSVVQVEKSKRDAEKSKK--AATAANEAISAGQ--

P32639|S.c.Brr2p          RLAKSTENEIPNLIEKMVAKGLNDLVEQYKFRETTHSKRELDSGDDQPQSSEAKRTKFSN

                                                                                     

 

Q8N3C0|H.S.HelC1          DVEK--------IHYPHVYDSQAEAMKTSAF-IAGAKMILPEGIQRENNKLYEEVRIPYS

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      KAEYKQSSYNQPIHYPYVFDSQLLAKQHAGF-IGGSRITLPDNAQRIDNKQWEEVKIPAS

Q9XWI5|C.E.Q9XWI5         --------------YPYVFDARLQNVGHTMFDINGMKFALPEGSKRDTFKTHESVYVPPS

P53327|S.C.Slh1p          --------------YPHVFR-KYEAGSTTAMAFAGQKFTLPVGTTRMSYNTHEEIIIPAA

O75643|H.S.U5-200KD       -----------ALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPAL

Q6P4T2|M.M.Ascc3l1        -----------ALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPAL

Q9VUV9|D.m.Brr2           -----------VAGVRQLLELEEMAFTQGSHFMANKRCQLPDGSYRKQRKGYEEVHVPAL

Q9U2G0|C.E.Brr2           -----------WQAGRKMLDLNDLTFSQGSHLMSNKRCELPDGSYRRQKKSYEEIHVPAL

P32639|S.c.Brr2p          ------------PAIPPVIDLEKIKFDESSKLMTVTKVSLPEGSFKRVKPQYDEIHIPAP

                                                                                      

 

Q8N3C0|H.S.HelC1          EPMP--LSFEEKPVYIQDLDEIGQLAFKGMKRLNR--IQSIVFETAYNTNENMLICAPTG

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      EPPP--LSVGNKRVQIEELDDVGRLAFANCKELNR--IQSVVFPVAYHSNENMLVCAPTG

Q9XWI5|C.E.Q9XWI5         NKGD--IEK-IQHVYVKDMDELGQKGFKGFEKLNV--IQSIVFEQAYKTKENLLICAPTG

P53327|S.C.Slh1p          DQASNKNYLYTKLLKISDLDHFCKTVFP-YETLNQ--IQSLVYPVAYKTNENMLICAPTG

O75643|H.S.U5-200KD       KPKP--FGSEEQLLPVEKLPKYAQAGFEGFKTLNR--IQSKLYRAALETDENLLLCAPTG

Q6P4T2|M.M.Ascc3l1        KPKP--FGSEEQLLPVEKLPKYAQAGFEGFKTLNR--IQSKLYRAALETDENLLLCAPTG

Q9VUV9|D.m.Brr2           KPVP--FDANEELQPVDKLPKYVQPVFEGFKTLNR--IQSRLYKAALDSDENMLLCAPTG

Q9U2G0|C.E.Brr2           KPRP--FAEGEKLVSVSELPKWAQPAFDGYKSLNR--IQSRLCDSALRSKEHLLLCAPTG

P32639|S.c.Brr2p          SKPV----IDYELKEITSLPDWCQEAFPSSETTSLNPIQSKVFHAAFEGDSNMLICAPTG

                                                                                     

 

Q8N3C0|H.S.HelC1          AGKTNIAMLTVLHEIRQH-FQQGV----IKKNEFKIVYVAPMKALAAEMTDYFSRRLEPL

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      AGKTNVAMLSIVHTIRCH-LEQGV----INRDEFKIVYIAPMKALAAEMVDNFSKRLKSL

Q9XWI5|C.E.Q9XWI5         AGKTNIAMLTILNTIHEHQNSRGD----IMKDDFKIIYIAPMKALATEMTESFGKRLAPL

P53327|S.C.Slh1p          AGKTDIALLTIINTIKQFSVVNGENEIDIQYDDFKVIYVAPLKALAAEIVDKFSKKLAPF

O75643|H.S.U5-200KD       AGKTNVALMCMLREIGKHINMDGT----INVDDFKIIYIAPMRSLVQEMVGSFGKRLATY

Q6P4T2|M.M.Ascc3l1        AGKTNVALMCMLREIGKHINMDGT----INVDDFKIIYIAPMRSLVQEMVGSFGKRLATY

Q9VUV9|D.m.Brr2           AGKTNVALLTMMREIGKHINEDGT----INAQDFKIIYVAPMKSLVQEMVGNFGRRLACY

Q9U2G0|C.E.Brr2           AGKTNVALLTMLQEIGNHLAEDGS----VKLDEFKIVYIAPMKSLVQEMVGSFSKRLAPF

P32639|S.c.Brr2p          SGKTNIALLTVLKALSHHYNPKTKK---LNLSAFKIVYIAPLKALVQEQVREFQRRLAFL

                                                                                     

 

Q8N3C0|H.S.HelC1          GIIVKELTGDMQLSKSEILRTQMLVTTPEKWDVVTRKSVGDVALSQIVRLLILDEVHLLH

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      QIAVRELTGDIQLTKAEMAATQILVTTPEKWDVVTRKGSGDVALISLVELLIIDEVHLLH

Q9XWI5|C.E.Q9XWI5         GLKVKELTGDTQLSRNEVADTQMLVLTPEKWDVITRKSTSDNSLINVVRLLIIDEVHLLH

P53327|S.C.Slh1p          NIQVRELTGDMQLTKAEILATQVIVTTPEKWDVVTRKANGDNDLVSKVKLLIIDEVHLLH

O75643|H.S.U5-200KD       GITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKG-GERTYTQLVRLIILDEIHLLH

Q6P4T2|M.M.Ascc3l1        GITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKG-GERTYTQLVRLIVLDEIHLLH

Q9VUV9|D.m.Brr2           NLTVSELTGDHQLTREQIAATQVIVCTPEKWDIITRKG-GERTFVSLVRLVIIDEIHLLH

Q9U2G0|C.E.Brr2           GITVGEMTGDAQMSKEQFMATQVIVCTPEKYDVVTRKG-GERAYNQMVRLLIIDEIHLLH

P32639|S.c.Brr2p          GIKVAELTGDSRLSRKQIDETQVLVSTPEKWDITTRNS-NNLAIVELVRLLIIDEIHLLH

                                                                                     

 

Q8N3C0|H.S.HelC1          EDRGPVLESIVARTLRQVESTQSMIRILGLSATLPNYLDVATFLHVNPYIGLFFFDGRFR

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      GERGPVVEALVARTLRLVESSQSMIRIVGLSATLPNYIDVAHFLRVNPMKGLFYFDSRFR

Q9XWI5|C.E.Q9XWI5         DERGPVIETLVARTLRQVEMSQSGIRIVGLSATLPNFIDVARFLRVNPYKGLFFFDGRFR

P53327|S.C.Slh1p          EDRGPVIETLVARTLRQVESSQSMIRIIGLSATLPNFMDVADFLGVNRQIGMFYFDQSFR

O75643|H.S.U5-200KD       DDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFR

Q6P4T2|M.M.Ascc3l1        DDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFR

Q9VUV9|D.m.Brr2           DERGPVLEALVARTIRNIETTQEEVRLVGLSATLPNYQDVATFLRVKPDKGLFYFDNSYR

Q9U2G0|C.E.Brr2           DDRGPVLESIVVRTIRQMEQNHDECRLVGLSATLPNYQDVATFLRVKP-EHLHFFDNSYR

P32639|S.c.Brr2p          DDRGPVLESIVARTFWASKYGQEYPRIIGLSATLPNYEDVGRFLRVPK-EGLFYFDSSFR

                                                                                      

 

Q8N3C0|H.S.HelC1          PVPLGQTFLGIKCANKMQQ-LNNMDEVCYENVLKQVKAGHQVMVFVHARNATVRTAMSLI

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      PVPLDTNFVGIKSVKQLQQ-IADMDQCCYQKCVEMVQEGHQIMVFVHARNATVRTANVIR

Q9XWI5|C.E.Q9XWI5         PVPLTQKFIGTRKAGNFRDNLTLMDNVCYDEVVDFVKRGHQVLVFVHTRNGTAKLGEAFC

P53327|S.C.Slh1p          PKPLEQQLLGCRGKAGSRQSKENIDKVAYDKLSEMIQRGYQVMVFVHSRKETVKSARNFI

O75643|H.S.U5-200KD       PVPLEQTYVGITEKKAIKR-FQIMNEIVYEKIMEHAGK-NQVLVFVHSRKETGKTARAIR

Q6P4T2|M.M.Ascc3l1        PVPLEQTYVGITEKKAIKR-FQIMNEIVYEKIMEHAGK-NQVLVFVHSRKETGKTARAIR

Q9VUV9|D.m.Brr2           PVSLEQQYIGVTEKKALKR-FQVMNEIVYEKTMEHAGR-NQVLVFVHSRKETGKTARAVR

Q9U2G0|C.E.Brr2           PVPLEQQYIGVTEKKALKR-FQAMNEVVYDKIMEHAGK-SQVLVFVHSRKETAKTAKAIR

P32639|S.c.Brr2p          PCPLSQQFCGIKERNSLKK-LKAMNDACYEKVLESINEGNQIIVFVHSRKETSRTATWLK

                                                                                     

 

Q8N3C0|H.S.HelC1          ERAKNCGHIPFFFPTQ--GHDYVLAEKQVQRSRN-KQVRELFPDGFSIHHAGMLRQDRNL

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      ELAQQNNTSALFLPKD--SAAHGLATRSIQRSRN-KQLVELFSCGLAMHHAGMLRADRQM

Q9XWI5|C.E.Q9XWI5         ARASVLGQMDLFLPKDRASSKYIQADKAINICRNRAQISPLFQRGMGIHHAGLCRQDRIL

P53327|S.C.Slh1p          KLAESNHEVDLFAPDP---IEKDKYSRSLVKNRD-KDMKEIFQFGFGIHHAGMARSDRNL

O75643|H.S.U5-200KD       DMCLEKDTLGLFLREG--SASTEVLRTEAEQCKN-LELKDLLPYGFAIHHAGMTRVDRTL

Q6P4T2|M.M.Ascc3l1        DMCLEKDTLGLFLREG--SASTEVLRTEAEQCKN-LELKDLLPYGFAIHHAGMTRVDRTL

Q9VUV9|D.m.Brr2           DMCLEQDTLGSFLKEG--SASMEVLRTEAEQVKN-TELKELLPYGFAIHHAGMTRVDRTL

Q9U2G0|C.E.Brr2           DACLEKDTLSAFMREG--SASTEILRTEAEQAKN-LDLKDLLPYGFAIHHAGMNRVDRTL

P32639|S.c.Brr2p          NKFAEENITHKLTKND--AGSKQILKTEAANVLD-PSLRKLIESGIGTHHAGLTRSDRSL

                                                                                     

 

Q8N3C0|H.S.HelC1          VENLFSNGHIKVLVCTATLAWGVNLPAHAVIIKGTQIYAAKRGSFVDLGILDVMQIFGRA

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      VEKYFVEGHISVLVCTATLAWGVNLPAHAVIIRGTDIYDAKHGSFVDLGILDVLQIFGRA

Q9XWI5|C.E.Q9XWI5         MERCFAEGHVSVLFCTATLAWGVNLPAHAVVIKGTDVFDAEKGVFTDLGVLDVQQIFGRA

P53327|S.C.Slh1p          TEKMFKDGAIKVLCCTATLAWGVNLPADCVIIKGTQVYDSKKGGFIDLGISDVIQIFGRG

O75643|H.S.U5-200KD       VEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRA

Q6P4T2|M.M.Ascc3l1        VEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRA

Q9VUV9|D.m.Brr2           VEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYNPEKGRWVELSALDVLQMLGRA

Q9U2G0|C.E.Brr2           VEDLFADRHIQVLFSTATLAWGVNLPAHTVIIKGTQIYNPEKGRWTELGALDIMQMLGRA

P32639|S.c.Brr2p          SEDLFADGLLQVLVCTATLAWGVNLPAHTVIIKGTDVYSPEKGSWEQLSPQDVLQMLGRA

                                                                                      

 

Q8N3C0|H.S.HelC1          GRPQFDKF-GEGIIITTHDKLSHYLTLLTQRNPIESQFLESLADNLNAEIALGTVTNVEE

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      GRPQFDKS-GVGTIITSYDKLNHYLSLLTNQFPIESNFVNCLADNLNAEIGLGTITNVDE

Q9XWI5|C.E.Q9XWI5         GRPQFENE-GHGIIITTRDKIDKYLTMLVHQNPIESQFYARLHDNLNAEVALGTVSTVDE

P53327|S.C.Slh1p          GRPGFGSANGTGILCTSNDRLDHYVSLITQQHPIESRFGSKLVDNLNAEISLGSVTNVDE

O75643|H.S.U5-200KD       GRPQYDTK-GEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKD

Q6P4T2|M.M.Ascc3l1        GRPQYDTK-GEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKD

Q9VUV9|D.m.Brr2           GRPQYDTK-GEGILITNHSELQFYLSLLNQQLPIESQFISKLPDMLNAEIVLGTVQHLQD

Q9U2G0|C.E.Brr2           GRPQYDDR-GEGILITNHSELQYYLSLMNQQLPVESQMVSRLTDMLNAEVVLGTVSSVSE

P32639|S.c.Brr2p          GRPRYDTF-GEGIIITDQSNVQYYLSVLNQQLPIESQFVSKLVDNLNAEVVAGNIKCRND

                                                                                      

 

Q8N3C0|H.S.HelC1          AVKWISYTYLYVRMRANPLAYGISHKAYQIDPTLRKHREQLVIEVGRKLDKAQMIRFEER

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      AIEWLSYTYLFVRMRINPHVYGIEYSELEKDPTLEARRRALIMSAAMSLDKARMMRFNQR

Q9XWI5|C.E.Q9XWI5         GVEWLTYTYMYTRALKNPMAYGIAYNAIERDPNLRDHFGNVIREAAMQLDQNKMIRFDMA

P53327|S.C.Slh1p          AIEWLGYTYMFVRMRKNPFTYGIDWEEIANDPQLYERRRKMIVVAARRLHALQMIVFDEV

O75643|H.S.U5-200KD       AVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKK

Q6P4T2|M.M.Ascc3l1        AVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKK

Q9VUV9|D.m.Brr2           AVNWLGYTYLYIRMLRNPTLYGVSHDAIKADPLLEQHRADLLHTAACCLERSGLIKYDRK

Q9U2G0|C.E.Brr2           ATNWLGYTFLFVRMLKNPTLYGITHEQARADPLLEQRRADLIHTACVLLDKAGLIKYDKR

P32639|S.c.Brr2p          AVNWLAYTYLYVRMLASPMLYKVP--DISSDGQLKKFRESLVHSALCILKEQELVLYDAE

                                                                                     

 

Q8N3C0|H.S.HelC1          TGYFSSTDLGRTASHYYIKYNTIETFNELFD---------AHKTEGDIFAIVSKAEEFDQ

Q6PB36|M.M.Ascc3.         ------------------------------------------------------------

Q9VF56|D.m.CG5205-PA      TMDMNITDLGRTASYFYIKYDTVETFNELMK---------PFMTQAEILAMISQAQEFQQ

Q9XWI5|C.E.Q9XWI5         TEYLNSTDLGRIASNFYVKYETIQLLNEAEKGVGLPVTFTSFMPDDMVIGLISMSTEFAN

P53327|S.C.Slh1p          SMHFIAKDLGRVSSDFYLLNESVEIFNQMCD---------PRATEADVLSMISMSSEFDG

O75643|H.S.U5-200KD       TGNFQVTELGRIASHYYITNDTVQTYNQLLK---------PTLSEIELFRVFSLSSEFKN

Q6P4T2|M.M.Ascc3l1        TGNFQVTELGRIASHYYITNDTVQTYNQLLK---------PTLSEIELFRVFSLSSEFKN

Q9VUV9|D.m.Brr2           TGHFQVTDLGRIASHYYLTHETMLTYNQLLK---------QTLSEIELFRVFSLSSEFRH

Q9U2G0|C.E.Brr2           SGIIQATELGRIASHFYCTYESMQTYNKLLV---------ETCSDIDLFRIFSMSSEFKL

P32639|S.c.Brr2p          NDVIEATDLGNIASSFYINHASMDVYNRELD---------EHTTQIDLFRIFSMSEEFKY

                                                                                     

 

Q8N3C0|H.S.HelC1          IKVREEEIEELDTLLSNFCELSTP-GGVENSYGKINILLQTYISRGEMDSFSLISDSAYV

Q6PB36|M.M.Ascc3.         -----------------------------------------------MDSFSLISDSAYV

Q9VF56|D.m.CG5205-PA      LKVRDDEMEELDELKNAYCKIKPY-GGSENVHGKVNILIQTYLSNGYVKSFSLSSDMSYI

Q9XWI5|C.E.Q9XWI5         LKCREEEIGDLEELMSYGCMMNVRGGGLASVAGKVNVLLQSLISRTSTRNSALMSEQLYV

P53327|S.C.Slh1p          IKFREEESKELKRLSDESVECQIG-SQLDTPQGKANVLLQAYISQTRIFDSALSSDSNYV

O75643|H.S.U5-200KD       ITVREEEKLELQKLLER-VPIPVK-ESIEEPSAKINVLLQAFISQLKLEGFALMADMVYV

Q6P4T2|M.M.Ascc3l1        ITVREEEKLELQKLLER-VPIPVK-ESIEEPSAKINVLLQAFISQLKLEGFALMADMVYV

Q9VUV9|D.m.Brr2           ISVREEEKLELQKLMER-VPIPIK-ESIEEHSAKVNVLLQAYISQLKLEGFALMSDMVFI

Q9U2G0|C.E.Brr2           LSVRDEEKLELQKMAEH-APIPIK-ENLDEASAKTNVLLQAYISQLKLEGFALQADMVFV

P32639|S.c.Brr2p          VSVRYEEKRELKQLLEK-APIPIR-EDIDDPLAKVNVLLQSYFSQLKFEGFALNSDIVFI

                                                                           . :* ::  ::

 

Q8N3C0|H.S.HelC1          AQNAARIVRALFEIALRKRWPTMTYRLLNLSKVIDKRLWGWASPLRQFS---ILPPHILT

Q6PB36|M.M.Ascc3.         AQNAARIVRALFEIALRKRWPTMTYRLLNLSKVIDKRLWGWASPLRQFS---VLPPHILT

Q9VF56|D.m.CG5205-PA      TTNIGRISRALFSIVLRQNNAVLSGNMLQLCKMFERRQWDFDCHLKQFP---TINAETID

Q9XWI5|C.E.Q9XWI5         QQNAGRLCRAMFEMVLKNGWSQAANAFLGIAKCVEKQMWMNQCALRQFIQIINIPITWIE

P53327|S.C.Slh1p          AQNSVRICRALFLIGVNRRWGKFSNVMLNICKSIEKRLWAFDHPLCQFD----LPENIIR

O75643|H.S.U5-200KD       TQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFR---KLPEEVVK

Q6P4T2|M.M.Ascc3l1        TQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFR---KLPEEVVK

Q9VUV9|D.m.Brr2           TQSAARLMRAIFEIVLTRGWAQLADKTLTLCKMIDRRMWQSMTPLRQFK---KMPDEIAK

Q9U2G0|C.E.Brr2           AQSAGRLFRALFEIVLWRGWAGLAQKVLTLCKMVTQRQWGSLNPLHQFK---KIPSEVVR

P32639|S.c.Brr2p          HQNAGRLLRAMFEICLKRGWGHPTRMLLNLCKSATTKMWPTNCPLRQFK---TCPVEVIK

                            .  *: **:* : : .     :   * :.*    : *     * **            

 

Q8N3C0|H.S.HelC1          RLEEKKLTVDKLKDMRK-DEIGHILHHVNIGLKVKQCVHQIPSVMMEASIQPITRTVLRV

Q6PB36|M.M.Ascc3.         RLEEKNLTVDKLKDMRK-DEIGHILHHVNIGLKVKQCVHQIPSVTMEASIQPITRTVLRV

Q9VF56|D.m.CG5205-PA      KLERRGLSVYRLRDMEH-RELKEWLRSNTYADLVIRSAHELPLLEVEASLQPITRTVLRI

Q9XWI5|C.E.Q9XWI5         KIERKKARESDLLELSA-KDLGYMFSCD--GDRLYTYLRYLPRMDVQAKFKPITYTIVQV

P53327|S.C.Slh1p          RIRDTKPSMEHLLELEA-DELGELVHNKKAGSRLYKILSRFPKINIEAEIFPITTNVMRI

O75643|H.S.U5-200KD       KIEKKNFPFERLYDLNH-NEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV

Q6P4T2|M.M.Ascc3l1        KIEKKNFPFERLYDLNH-NEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV

Q9VUV9|D.m.Brr2           KLEKKHFPWGRLYDLEP-HELGELIRVPKLGKTIHKFVHQFPKLELSTHIQPITRGTLRV

Q9U2G0|C.E.Brr2           SIDKKNYSFDRLYDLDQ-HQLGDLIKMPKMGKPLFKFIRQFPKLEMTTLIQPITRTTMRI

P32639|S.c.Brr2p          RLEASTVPWGDYLQLETPAEVGRAIRSEKYGKQVYDLLKRFPKMSVTCNAQPITRSVMRF

                           :           ::    ::   .     .  :      :* : :     ***   ::.

 

Q8N3C0|H.S.HelC1          TLSIYADFTWNDQVHGTVG-EPWWIWVEDPTNDHIYHSEYFLALKKQVISKEAQLLVFTI

Q6PB36|M.M.Ascc3.         SLNIHPDFSWNDQVHGTVG-EPWWIWVEDPTNDHIYHSEYFLALKKQVINKEAQLLVFTI

Q9VF56|D.m.CG5205-PA      KVDIWPSFTWNDRVHGKTC-QSFWLWIEDPESNYIYHSELFQVTRKLVMSGQSQQLVMTI

Q9XWI5|C.E.Q9XWI5         EVTLTPTFIWNDQIHGKSGQQSFYLVLENLNENLIIHQERIGIGKMKVNRQETQNLVFTI

P53327|S.C.Slh1p          HIALGPDFVWDSRIHGDAQ--FFWVFVEESDKSQILHFEKFILNRRQLNN--QHEMDFMI

O75643|H.S.U5-200KD       ELTITPDFQWDEKVHGSSE--AFWILVEDVDSEVILHHEYFLLKAKYAQD--EHLITFFV

Q6P4T2|M.M.Ascc3l1        ELTITPDFQWDEKVHGSSE--AFWILVEDVDSEVILHHEYFLLKAKYAQD--EHLITFFV

Q9VUV9|D.m.Brr2           ELTITPDFQWDEKVHGQSE--GFWVLIEDVDSELILHHEFFLLKQKYSQD--EHQLKFFV

Q9U2G0|C.E.Brr2           ELTITPDFKWDEKVHGSAE--GFWIFIEDTDGEKILHHEFFLLKQKFCSD--EHVVKMIV

P32639|S.c.Brr2p          NIEIIADWIWDMNVHGSLE--PFLLMLEDTDGDSILYYDVLFITPDIVGHEFTLSFTYEL

                           : : . : *: .:**      : : :*:   . * : : :              .   :

 

Q8N3C0|H.S.HelC1          PIFEP--LPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPITALGC

Q6PB36|M.M.Ascc3.         PIFEP--LPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLPITALGC

Q9VF56|D.m.CG5205-PA      PLKEP--LPPQYYIRVSSDNWLGSTTCIPLSFQHLVLPEHHPPLTELLPLRPLPVSCLKN

Q9XWI5|C.E.Q9XWI5         PIVDCQ-LTNNFQLRLASEYFVTDDVVVPMSLHNCILPKSFKSHTDLLDLEPLPIKTLKN

P53327|S.C.Slh1p          PLSDP--LPPQVVVKVVSDTWIGCESTHAISFQHLIRPFNETLQTKLLKLRPLPTSALQN

O75643|H.S.U5-200KD       PVFEP--LPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRN

Q6P4T2|M.M.Ascc3l1        PVFEP--LPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRN

Q9VUV9|D.m.Brr2           PVFEP--LPPQYFLRIVSDRWIGAETQLPVSFRHLILPEKNMPPTELLDLQPLPISALRQ

Q9U2G0|C.E.Brr2           PMFDP--MPPLYYVRIVSDRWIGAETVLPISFRHLILPEKYPPPTELLDLQPLPISAVTN

P32639|S.c.Brr2p          KQHNQNNLPPNFFLTLISENWWHSEFEIPVSFNGFKLPKKFPPPTPLLENISISTSELGN

                             :   :.    :   *: :        :.:.    *      * **   .:. . : 

 

Q8N3C0|H.S.HelC1          KAYEALYNFS---HFNPVQTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNKYPT

Q6PB36|M.M.Ascc3.         KAYEALYNFS---HFNPVQTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNKYPT

Q9VF56|D.m.CG5205-PA      VVYESLYKFT---HFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIVAEIAIFRALNQNPK

Q9XWI5|C.E.Q9XWI5         SKFEAIYNFD---YFNPIQAQVFFCLYKTDKSALIGAPTGSGKTLCAELAMFRLLQDHPG

P53327|S.C.Slh1p          PLIESIYPFK---YFNPMQTMTFYTLYNTNENAFVGSPTGSGKTIVAELAIWHAFKTFPG

O75643|H.S.U5-200KD       SAFESLYQDK-FPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSE

Q6P4T2|M.M.Ascc3l1        SAFESLYQDK-FPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNSE

Q9VUV9|D.m.Brr2           PKFESFYSQR-FPQFNPIQTQVFNAVYNSDENVFVGAPTGSGKMTIAEFAIMRLFTTQSD

Q9U2G0|C.E.Brr2           KEFQTVFAESGFKVFNPIQTQVFRTVFESNENVIVCAPNGSGKTAIAELAVLRHFENTPE

P32639|S.c.Brr2p          DDFSEVFEFK---TFNKIQSQVFESLYNSNDSVFVGSGKGTGKTAMAELALLNHWRQNKG

                             . .:       ** :*:  *  ::.:: ..:: : .*:**   **:*: .      

 

Q8N3C0|H.S.HelC1          SKAVYIAPLKALVRERMDDWKVRIEEK-LGKKVIELTGDVTPDMKSIAKADLIVTTPEKW

Q6PB36|M.M.Ascc3.         SKAVYIAPLKALVRERMDDWKIRIEEK-LGKKVIELTGDVTPDMKSIAKADLIVTTPEKW

Q9VF56|D.m.CG5205-PA      CKVVYIAPLKALVKERIADWEQRFQRSSLGLKVVELTGDVTPDIQAIRESQLIVTTPEKW

Q9XWI5|C.E.Q9XWI5         MKVVYIAPLKSLVRERVDDWKKKFEDG-MGYRVVEVSGDVTPDPEELAASSILITTPEKW

P53327|S.C.Slh1p          KKIVYIAPMKALVRERVDDWRKKITPV-TGDKVVELTGDSLPDPKDVHDATIVITTPEKF

O75643|H.S.U5-200KD       GRCVYITPMEALAEQVYMDWYEKFQDR-LNKKVVLLTGETSTDLKLLGKGNIIISTPEKW

Q6P4T2|M.M.Ascc3l1        GRCVYITPMEALAEQVYMDWYEKFQDR-LNKKVVLLTGETSTDLKLLGKGNIIISTPEKW

Q9VUV9|D.m.Brr2           ARCVYLVSEEALADLVFADWHSKFGS--LDIKVVKLTGETGTDLKLIAKGQLVITTADKW

Q9U2G0|C.E.Brr2           AKAVYITPMEDMATKVYADWKRRLEPA-IGHTIVLLTGEQTMDLKLAQRGQLIISTPERW

P32639|S.c.Brr2p          -RAVYINPSGEKIDFLLSDWNKRFSHLAGGKIINKLGNDPSLNLKLLAKSHVLLATPVQF

                           : **: .          **  ::     .  :  : .:   : :    . ::::*. ::

 

Q8N3C0|H.S.HelC1          DGVSRSWQNRNYVQQVTILIIDEIHLLGE-ERGPVLEVIVSRTNFIS---SHTEKPVRIV

Q6PB36|M.M.Ascc3.         DGVSRSWQNRSYVQQVNILIIDEIHLLGE-ERGPVLEVIVSRTNFIS---SHTEKPVRIV

Q9VF56|D.m.CG5205-PA      DGISRSWQTREYVQHVSLIVIDEIHLLGE-DRGPVIEVIVSRTNFIS---SHTGRAIRIV

Q9XWI5|C.E.Q9XWI5         DGISRSWATREYVRRVGLIVLDEVHLLGV-DRGAVLEAIVSRLKMITRRSHVTEEPVRLL

P53327|S.C.Slh1p          DGISRNWQTRKFVQDVSLIIMDEIHLLAS-DRGPILEMIVSRMNYIS---SQTKQPVRLL

O75643|H.S.U5-200KD       DILSRRWKQRKNVQNINLFVVDEVHLIGG-ENGPVLEVICSRMRYIS---SQIERPIRIV

Q6P4T2|M.M.Ascc3l1        DILSRRWKQRKNVQNINLFVVDEVHLIGG-ENGPVLEVICSRMRYIS---SQIERPIRIV

Q9VUV9|D.m.Brr2           DVLSRRWKQRKNVQLVNLFIVDELQLVGG-EEGPVLEIVCSRMRYIS---SQIEKQIRIV

Q9U2G0|C.E.Brr2           DNISRRWKQRKSVQNVKLFIADDLHMIGA-SNGAVFEVVCSRTRYIS---SQLESAVRVV

P32639|S.c.Brr2p          ELLSRRWRQRKNIQSLELMIYDDAHEISQGVYGAVYETLISRMIFIA---TQLEKKIRFV

                          : :** *  *. :: : ::: *: : :.    *.: * : **   *:         :*.:

 

Q8N3C0|H.S.HelC1          GLSTALANARDLADWLNIKQMGLFNFRPSVRPVPLEVHIQGFPG-QHYCPRMASMNKPAF

Q6PB36|M.M.Ascc3.         GLSTALANARDLADWLNIKQMGLFNFRPSVRPVPLEVHIQGFPG-QHYCPRMASMNKPAF

Q9VF56|D.m.CG5205-PA      GLSTALANAQDLANWLGINKMGLYNFKPSVRPVPLQVHINGFPG-KHYCPRMATMNRPTF

Q9XWI5|C.E.Q9XWI5         GLSTALANAGDVAEWLGIPDEACYNFRPSVRPVPISVHIQGFPG-QHYCPRMGLMNKPAY

P53327|S.C.Slh1p          GMSTAVSNAYDMAGWLGVKDHGLYNFPSSVRPVPLKMYIDGFPDNLAFCPLMKTMNKPVF

O75643|H.S.U5-200KD       ALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNI-SHTQTRLLSMAKPVY

Q6P4T2|M.M.Ascc3l1        ALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNI-SHTQTRLLSMAKPVY

Q9VUV9|D.m.Brr2           ALSASLTDARDVAQWLGCNPNATFNFHPSVRPIPLELHIQGYNV-THNATRIATMSKPVY

Q9U2G0|C.E.Brr2           ALSSSLTNARDLGMWLGCSASATFNFMPSTRPVPLDLEIKSFNL-SHNASRFAAMERPVY

P32639|S.c.Brr2p          CLSNCLANARDFGEWAGMTKSNIYNFSPSERIEPLEINIQSFKDVEHISFNFSMLQMAFE

                           :* .:::* *.. * .      :** .. *  *:.: *..:         :  :  . 

 

Q8N3C0|H.S.HelC1          QAIRSHS---PAKPVLIFVSSRRQTRLTALELIAFLATEEDPKQWLNMD-ERE-MENIIA

Q6PB36|M.M.Ascc3.         QAIRSHS---PAKPVLIFVSSRRQTRLTALELIAFLATEEDPKQWLNMD-EQE-MDNIIG

Q9VF56|D.m.CG5205-PA      QAIRTYS---PCEPTIVFVSSRRQTRLTALDLITFVAGESNPKQFLHIP-EDE-IELILQ

Q9XWI5|C.E.Q9XWI5         KAILTYS---PRKPVLIFVSSRRQTRLTALAFVNLLIADHNPKQWLNMD-MLE-LEDLMA

P53327|S.C.Slh1p          MAIKQHS---PDKPALIFVASRRQTRLTALDLIHLCGMEDNPRRFLNIDDEEE-LQYYLS

O75643|H.S.U5-200KD       HAITKHS---PKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKD--LIPYLE

Q6P4T2|M.M.Ascc3l1        HAITKHS---PKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKD--LIPYLE

Q9VUV9|D.m.Brr2           NAILKYS---AHKPVIVFVSSRKQARLTAIDVLTYAASDLQPNRFFHAEEED--IKPFLE

Q9U2G0|C.E.Brr2           QAICRHAGKLEPKPALVFVPVRRQTRPVAVALLTMALADGAPKRFLRLAEHDDTFQALLA

P32639|S.c.Brr2p          ASAAAAG---NRNSSSVFLPSRKDCMEVASAFMKFSK----AIEWDMLNVEEEQIVPYIE

                           :    .     :.  :*:. *::   .*  .:          .:         :   :

 

Q8N3C0|H.S.HelC1          TVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVI

Q6PB36|M.M.Ascc3.         TVRDSNLKLTLAFGIGMHHAGLHERDRKTVEELFVNCKVQVLIATSTLAWGVNFPAHLVI

Q9VF56|D.m.CG5205-PA      NIREQNLKFCLAFGIGLHHAGLQEQDRKCVEELFLNRKIQILVATATLAWGVNLPAHLVV

Q9XWI5|C.E.Q9XWI5         AIKDENLKLTLPFGIGMHHAGLSAHERAIVEQLFIEKKIQVLIATATLAWGINCPAHLVI

P53327|S.C.Slh1p          QVTDDTLKLSLQFGIGLHHAGLVQKDRSISHQLFQKNKIQILIATSTLAWGVNLPAHLVI

O75643|H.S.U5-200KD       KLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVI

Q6P4T2|M.M.Ascc3l1        KLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVI

Q9VUV9|D.m.Brr2           RMTDKTLKETLAQGVAYLHEGLSASDHRLVEQLFDSGAVQVAVISRDLCWGMSISAHLVI

Q9U2G0|C.E.Brr2           DIEDESLRESVSCGVGFLHEGTAPKDVHIVQQLFESNAIQVCVVPRGMCYQIEMSAYLVV

P32639|S.c.Brr2p          KLTDGHLRAPLKHGVGILYKGMASNDERIVKRLYEYGAVSVLLIS-KDCSAFACKTDEVI

                           : :  *:  :  *:.  : *    :    ..*:    :.: : .   .  .   :  *:

 

Q8N3C0|H.S.HelC1          IKGTEYYDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPF

Q6PB36|M.M.Ascc3.         IKGTEYYDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPF

Q9VF56|D.m.CG5205-PA      IKGTEYFDGKVKKYVDMPITDVLQMMGRAGRPQFDNEGVAVVLVHDEKKNFYKKFLYDPF

Q9XWI5|C.E.Q9XWI5         VKGTEYFDGKKGKYVDFPVTDVLQMMGRAGRPQFDDSAVAVIYVQDAKKTFYKKFLYEPF

P53327|S.C.Slh1p          IKGTQFFDAKIEGYRDMDLTDILQMMGRAGRPAYDTTGTAIVYTKESKKMFYKHFLNVGF

O75643|H.S.U5-200KD       IMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPL

Q6P4T2|M.M.Ascc3l1        IMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPL

Q9VUV9|D.m.Brr2           IMDTQFYNGKNHSYEDYPITDVLQMIGRANRPNEDADAKCVLMCQSSKKDFFKKFINEPL

Q9U2G0|C.E.Brr2           VMDTQFYNGKYHVYEDYPIADMLHMVGLANRPILDSDAKCVVMCQTSKRAYYKKFLCDPL

P32639|S.c.Brr2p          ILGTNLYDGAEHKYMPYTINELLEMVGLASGND-SMAGKVLILTSHNMKAYYKKFLIEPL

                          : .*: ::.    *    : ::*.*:* *.    .  .  ::      : ::*:*:   :

 

Q8N3C0|H.S.HelC1          PVESSLLGVLSDHLNAEIAGGTITSKQDALDYITWTYFFRRLIMNPSYYNLGDVSHDS-V

Q6PB36|M.M.Ascc3.         PVESSLLGVLSDHLNAEIAGGTITSKQDAMDYITWTYFFRRLIMNPSYYSLGDVSQDS-I

Q9VF56|D.m.CG5205-PA      PVESSLLGVLPEHINAEIVAGTVQSKQAALDYLTWTYFFRRLLRNPSYYQLQDIEPEN-V

Q9XWI5|C.E.Q9XWI5         PVESSLLPVLPNHVNAEISAGTIDSKQAIVEYLSKTYLYRRLFANPNYYGLEEDSEEA-M

P53327|S.C.Slh1p          PVESSLHKVLDDHLGAEITSGSITNKQEALDFLSWTFLFRRAHHNPTYYGIEDDTSTAGV

O75643|H.S.U5-200KD       PVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRH-L

Q6P4T2|M.M.Ascc3l1        PVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRH-L

Q9VUV9|D.m.Brr2           PIESHLDHRMHDHFNAEVVTKTIENKQDAVDYLTWTFLYRRLTQNPNYYNLQGVTHRH-L

Q9U2G0|C.E.Brr2           PVESHLDHCLHDHFNAEIVTKTIENKQDAIDYLTWTLLYRRMTQNPNYYNLQGTTHRH-L

P32639|S.c.Brr2p          PTESYLQYIIHDTLNNEIANSIIQSKQDCVDWFTYSYFYRRIHVNPSYYGVRDTSPHG-I

                          * ** *   : : .. *:    : .**  ::::: : ::**   **.** :        :

 

Q8N3C0|H.S.HelC1          NKFLSHLIEKSLIELELSYCIEI---------------GEDNRSIEPLTYGRIASYYYLK

Q6PB36|M.M.Ascc3.         NKFLSHLIGQSLVELELSHCIEV---------------GEDNRTIEPLTCGLIASYYYLK

Q9VF56|D.m.CG5205-PA      NNFMSNLVERVVYELSAAACLVE---------------RDG--CLIPTFLGRISSYYYLS

Q9XWI5|C.E.Q9XWI5         LKFITKIVDDSVAELLASECIHV---------------DSEQDVIKPTPCGRIASVYYLQ

P53327|S.C.Slh1p          SEHLSSLIDSTLENLRESQCVLL---------------HGDDIVATPFLS--ISSYYYIS

O75643|H.S.U5-200KD       SDHLSELVEQTLSDLEQSKCIS----------------IEDEMDVAPLNLGMIAAYYYIN

Q6P4T2|M.M.Ascc3l1        SDHLSELVEQTLSDLEQSKCIS----------------IEDEMDVAPLNLGMIAAYYYIN

Q9VUV9|D.m.Brr2           SDHLSELVENTLSDLEQSKCIS----------------VEDDMDTLPLNLGMIAAYYYIN

Q9U2G0|C.E.Brr2           SDALSELVELTLKDLENSKCIA----------------VKDEMDTVSLNLGMIASYYYIS

P32639|S.c.Brr2p          SVFLSNLVETCLNDLVESSFIEIDDTEAEVTAEVNGGDDEATEIISTLSNGLIASHYGVS

                             :: ::   : :*  :  :                         .     *:: * :.

 

Q8N3C0|H.S.HelC1          HQTVKMFKDRLKPECSTEELLSILSDAEEYTDLPVRHNEDHMNSELAKCLPIESNPHS--

Q6PB36|M.M.Ascc3.         HKTVKMFKDRLKPECSTEELLSILSDAEEYTDLPVRHNEDHTNNELAKCLPIELNPHS--

Q9VF56|D.m.CG5205-PA      YRTMKHFLEDLQPGMNTKKVLLAIADSYEFDQLPVRHNEDKHNEEMAEVSRFRPPSSS--

Q9XWI5|C.E.Q9XWI5         HETVRFLVKSLHSGCSVENMLKILTDVPEYAEIPVRHNEDLINTELQKKLRIRFSTSV--

P53327|S.C.Slh1p          HLTIRQLLKQIHDHATFQEVLRWLSLAVEYNELPVRGGEIIMNEEMSQQSRYSVESTFTD

O75643|H.S.U5-200KD       YTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNP---

Q6P4T2|M.M.Ascc3l1        YTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNP---

Q9VUV9|D.m.Brr2           YTTIELFSLSLNSKTKVRGLLEIISSAAEYEDVVVRHHEEQVLRTLSQRLPNKLTGPN--

Q9U2G0|C.E.Brr2           YQTIELFSMSLKEKTKTRALIEIISASSEFGNVPMRHKEDVILRQLAERLPGQLKNQ---

P32639|S.c.Brr2p          FFTIQSFVSSLSNTSTLKNMLYVLSTAVEFESVPLRKGDRALLVKLSKRLPLRFPEHTS-

                          . *:. :   :    . . ::  ::   *: .: :*  :      : :           

 

Q8N3C0|H.S.HelC1          -----FDSPHTKAHLLLQAHLSRAMLPCPDYDTDTKTVLDQALRVCQAMLDVAANQGWLV

Q6PB36|M.M.Ascc3.         -----FDSPHTKAHLLLQAHLSRAMLPCPDYDTDTKTVLDQALRVCQAMLDVAASQGWLV

Q9VF56|D.m.CG5205-PA      -----WDSSYTKTFLLLQAHFARQSLPNSDYLTDTKSALDNATRVMQAMVDYTAERGWLS

Q9XWI5|C.E.Q9XWI5         -----MGTSACKAHLLFQAHFMRTVLP-TDYRTDLKSVLDQCIRILQAMREMARLKNWLS

P53327|S.C.Slh1p          EFELPMWDPHVKTFLLLQAHLSRVDLPIADYIQDTVSVLDQSLRILQAYIDVASELGYFH

O75643|H.S.U5-200KD       ----KFNDPHVKTNLLLQAHLSRMQLS-AELQSDTEEILSKAIRLIQACVDVLSSNGWLS

Q6P4T2|M.M.Ascc3l1        ----KFNDPHVKTNLLLQAHLSRMQLS-AELQSDTEEILSKAIRLIQACVDVLSSNGWLS

Q9VUV9|D.m.Brr2           ETAPKFNDPHIKTNLLLQAHLSRLQLG-PELQGDTEQILSKAIRLIQACVDVLSSNGWLS

Q9U2G0|C.E.Brr2           ----KFTDPHVKVNLLIHAHLSRVKLT-AELNKDTELIVLRACRLVQACVDVLSSNGWLS

P32639|S.c.Brr2p          -----SGSVSFKVFLLLQAYFSRLELP-VDFQNDLKDILEKVVPLINVVVDILSANGYLN

                                     *. **::*:: *  *   :   *    : .   : :.  :     .::

 

Q8N3C0|H.S.HelC1          TVLNITNLIQMVIQGRWLKDSSLLTLPNIENHHLHLFKKWKPIMKGPHARGRTSIESLPE

Q6PB36|M.M.Ascc3.         TVLNITHLIQMVIQGRWLKDSSLLTIPNIEQHHLHLFRKWKPPVKSSHAKCRTSIECLPE

Q9VF56|D.m.CG5205-PA      TTLVVQQLMQSVIQARWFDGSEFLTLPGVNEDNLDAFLNIP--------HDDYDYLTLPV

Q9XWI5|C.E.Q9XWI5         ATMNIILLQQMCHSARWHDDHPLLCLPHLSHEDARSIGDGMTIP---QLQNHLEIEKSTS

P53327|S.C.Slh1p          TVLTMIKMMQCIKQGYWYEDDPVSVLPGLQLRRIKDY--------------TFSEQGFIE

O75643|H.S.U5-200KD       PALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCT-------------DKGVESVFD

Q6P4T2|M.M.Ascc3l1        PALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCT-------------DKGVESVFD

Q9VUV9|D.m.Brr2           PAVAAMELAQMVTQAMWSKDSYLKQLPHFSPEIVKRCT-------------EKKIETVFD

Q9U2G0|C.E.Brr2           PAIHAMELSQMLTQAMYSNEPYLKQLPHCSAALLERAK-------------AKEVTSVFE

P32639|S.c.Brr2p          -ATTAMDLAQMLIQGVWDVDNPLRQIPHFNNKILEKCK-------------EINVETVYD

                           .     : *   .. :     .  :*                                

 

Q8N3C0|H.S.HelC1          LIHACGGKDHVFSSMVESELHAAKTKQAWNFLSHLPVINVGISVKGSWDDLVEGHNELSV

Q6PB36|M.M.Ascc3.         LIHACEGKDHVFSSMVEKELQPAKTKQAWNFLSRLPVINVGISVKGSWDDLVEGHNELSI

Q9VF56|D.m.CG5205-PA      LKELCKQEYEVLAKPLRDAFEEHEIEKMYKVIQDLPEIAIQIFVEG-----RHMENEYAK

Q9XWI5|C.E.Q9XWI5         LDDAKLARRAQKLFRECTKLDEAQSREVLKALCNWPIINMKI------------MQLVDS

P53327|S.C.Slh1p          MTPQQKKK----KLLTLEEIGRFGYKKLLNVFDQLTFGMTES------------EDTKKR

O75643|H.S.U5-200KD       IMEMEDEE-----RNALLQLTDSQIADVARFCNRYPNIELSY------------------

Q6P4T2|M.M.Ascc3l1        IMEMEDEE-----RNALLQLTDSQIADVARFCNRYPNIELSY------------------

Q9VUV9|D.m.Brr2           IMELEDED-----RTRLLQLSDLQMADVARFCNRYPNIELNY------------------

Q9U2G0|C.E.Brr2           LLELENDD-----RSDILQMEGAELADVARFCNHYPSIEVAT------------------

P32639|S.c.Brr2p          IMALEDEE-----RDEILTLTDSQLAQVAAFVNNYPNVELTY------------------

                          :                  :      .        .                       

 

Q8N3C0|H.S.HelC1          STLTADKRDDNKWIKLHADQEYVLQVSLQRVHFGFHK--GKPESCAVTPRFPKSK-DEGW

Q6PB36|M.M.Ascc3.         STLTADKRDENKWIKLHADQEYVLQVSLQRVHFGLPK--GKHENHAVTPRFPKLK-DEGW

Q9VF56|D.m.CG5205-PA      RPLSLSDDTRGEWMSLHANEDYVLIVNLQRLNVSGQRRGGGQSYTVHCPKYPKPK-NEAW

Q9XWI5|C.E.Q9XWI5         RGNCVDIDETKKPVKVTAGEVYKLRIVMERVGP------GKNNSSMHLPQWPKPK-QAGW

P53327|S.C.Slh1p          FVSVCQRLPVLEGMKFEEQENNEVLTFYSKHLSSKHN----NGFEVYCDKFPKIQ-KELW

O75643|H.S.U5-200KD       --------EVVDKDSIRSGGPVVVLVQLEREEEVTG--------PVIAPLFPQKR-EEGW

Q6P4T2|M.M.Ascc3l1        --------EVVDKDSIRSGGPVVVLVQLEREEEVTG--------PVIAPLFPQKR-EEGW

Q9VUV9|D.m.Brr2           --------EVVDKDRINSGSTVNVVVQLEREDEVTG--------PVIAPFFPQKR-EEGW

Q9U2G0|C.E.Brr2           --------ELEN-DVVTSNDNLMLAVSLERDNDIDGL-----APPVVAPLFPQKRKEEGW

P32639|S.c.Brr2p          --------SLNNSDSLISGVKQKITIQLTRDVEPEN-------LQVTSEKYPFDK-LESW

                                     .   .       :     :                    :*  :    *

 

Q8N3C0|H.S.HelC1          FLILGEVDKRELIALKRVG--YIRNHHVASLSFYTPEIPGRYIYTLYFMSDCYLGLDQQY

Q6PB36|M.M.Ascc3.         FLILGEVDKRELMAVKRVG--FVRTHHDASISFFTPETPGRYIFTLYLMSDCYLGLDQQY

Q9VF56|D.m.CG5205-PA      FLTLGSQANDELLAMKRVS--IRGQRCTNRISFQATPRLGRLQLTLYLMSDCLMGFDQQY

Q9XWI5|C.E.Q9XWI5         IIVVGNVSADMILNTTTVTG-SHSTRSTAKLDIRAPATKGNHELAVLILSDCYLGIDQEY

P53327|S.C.Slh1p          FLIG--HKGDELLMIKRCQPKQMNKEVIIHCDLFIPEEIRGEELQFSLINDALG---LRY

O75643|H.S.U5-200KD       WVVIGDAKSNSLISIKRLT---LQQKAKVKLDFVAPAT-GAHNYTLYFMSDAYMGCDQEY

Q6P4T2|M.M.Ascc3l1        WVVIGDAKSNSLISIKRLT---LQQKAKVKLDFVAPAT-GGHNYTLYFMSDAYMGCDQEY

Q9VUV9|D.m.Brr2           WVVIGDPKTNSLLSIKRLT---LQQKAKVKLDFVAPSP-GKHDYTLYYMSDSYLGCDQEY

Q9U2G0|C.E.Brr2           WLVIGDSESNALLTIKRLV---INEKSSVQLDFAAPRP-GHHKFKLFFISDSYLGADQEF

P32639|S.c.Brr2p          WLVLGEVSKKELYAIKKVT---LNKETQQYELEFDTPTSGKHNLTIWCVCDSYLDADKEL

                           :         :   .         .         .         .  : *.      .

 

Q8N3C0|H.S.HelC1          DIYLNVTQASLSAQVNTKVSDSLTDLALK

Q6PB36|M.M.Ascc3.         DIYLNVIKANIS----TKDSDVFTDLSV-

Q9VF56|D.m.CG5205-PA      DLQFEIIDAKEV-----------------

Q9XWI5|C.E.Q9XWI5         TLRLDVC----------------------

P53327|S.C.Slh1p          DMVHKLIS---------------------

O75643|H.S.U5-200KD       KFSVDVKEAETDS-----DSD--------

Q6P4T2|M.M.Ascc3l1        KFSVDVKEAETDS-----DSD--------

Q9VUV9|D.m.Brr2           KFSIEVGDFQSES-----ESESD------

Q9U2G0|C.E.Brr2           DVAFKVEEPGRSNRKRKHEKEED------

P32639|S.c.Brr2p          SFEINVK----------------------

                           .  .: