S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Sen1p
YLR430W

CG7504 Setx SETX
Database Links  
Cellular Function Transcription Transcription

Group Alignment

Sen1_H.s.     MSTCCWCTPGGASTIDFLKRYASNTPSGEFQTADEDLCYCLECVAEYHKARDELPFLHEV

Sen1_M.m.     MSTCCWCTPGGSSTIDVLKRYASSTGSSEFQTADEDLCYCLECVAEYHRARDEVPFLHEV

CG_7504_D.m.  MSSV-W-------------------------------------------------YLEHV

YLR430W_S.c.  MNSN-NPDNNNSNNINNNNKDKDIAPNSDVQLA-----------TVYTKAKSYIPQIEQV

 

 

Sen1_H.s.     L----WELETLRLINHFEKSMKAEIGDDDELYIVDNNGEMPLFDITGQDFENKLRVPLLE

Sen1_M.m.     L----WELETLRLVSHFEKSMKAEAEDDDDLYIVDNNGEEQLFDCSGQDFENKLRVPLFE

CG_7504_D.m.  T-------TGARLILH----------NGTNL------------------MGRHSRCRIIL

YLR430W_S.c.  YQGTNPNIQEAKLLGELLQVL-AEVPKGTHLFCDPILEPISIFSLTIFSFNEEATATWLK

 

 

Sen1_H.s.     ILKYPYLLLHERVNELCVEALCRMEQANCSFQVFDKHPGIYLFLVHPNEMVRRWAILTAR

Sen1_M.m.     ILKYPYLLLHERVNELCVEALCRMEQNNCSFQVFDKYPGIYLFLVHPNEMVRRWAILTAR

CG_7504_D.m.  GGQYQFVS-REHANIIVSEKGVEVES-------LNPLNGLFINGGKLGDKINRLAV----

YLR430W_S.c.  NHFNPILSVCDKCILNFARGKCKMLQH---FAIQRHVP--HEHVAKFNDIVCQWRV----

 

 

Sen1_H.s.     NLGKVDRDDYYDLQEVLLCLFKVIELGLLESPDIYTSSVLEKGKLILLPSHMYDTTNYKS

Sen1_M.m.     NLGKVDRDDYYDLQEVLTCLFKVIELGLLESPDIYTSSVLEKGKLILLPAHMYDTTNYKN

CG_7504_D.m.  -------------AEGSTISLGVTGVNLNEITGIHAIFILKKK-----------------

YLR430W_S.c.  --------------EAVFPILRNISVN--DNTGINITNEIETA--------MYE------

 

 

Sen1_H.s.     YWLGICMLLTILEEQAMDSLLLGSDKQNDFMQSILHTMEREADDDSVDPFWPALHCFMVI

Sen1_M.m.     YWLGICMLLTILEEQAMDSLLLGSDKQNDFMQSILHTMEKQSDDDSMDPFWPALHCFMVI

CG_7504_D.m.  -------------------------------EPVVEEIVLSSDDDDTTPL-PAVRC----

YLR430W_S.c.  -----CL---------CNPHMLRLNKQ---LKATFEAI--------FKFFYDTKHRLLDV

 

 

Sen1_H.s.     LDRLGSKVWGQLMDPIVAFQTIINNASYNREIRHIRNSSVRTKLEPESYLDDMVTCSQIV

Sen1_M.m.     LDRLGSKVWGQLIDPIEAFQTIINNESYNREIQNIRNSSIRTKLEPEPHFDDMVTCSQIV

CG_7504_D.m.  --PTGTQ-------------------------------------------PTEFNLKQQI

YLR430W_S.c.  TNPLSIKTF----------------------------------------------ISGVI

 

 

Sen1_H.s.     YNYNPEKTKKDSGWRTAICPD-YCPNMYEEMETLASVLQSDIGQDMRVHNSTFLWFIPFV

Sen1_M.m.     YNFNPEKTKKDSGWRSAICPD-YCPNMYEEMETLANVLQSDIGQDMRVHNSTFLWFIPFV

CG_7504_D.m.  PNF---GGKQDPGQEEEVLPS--SSNLH--LPKLT-----EVKQEIVKHTSEE------I

YLR430W_S.c.  FCWC-EGSKEENEWSRAFLKDLYSRNFHINLSNLT----PDIIEEVYIH-------ILFL

 

 

Sen1_H.s.     QSLM-DLKDLGVAYIAQVVNHLYSEVKEVLNQTDAVCDKVTEFFLLILVSVIELHRNKKC

Sen1_M.m.     QSLM-DLKDLGVAYIVEVIHHLYSEVKDVLNQTDAVCDKVTEFFILILISVIELHRNKKC

CG_7504_D.m.  QNIFGEPSDAILNSVLELNPYLYNKLTNKTANNEITRKKIHD------------------

YLR430W_S.c.  QNPA-NWTEI-------VVSQFWSRLLPVFNLFDK--DVFIEYF--------QVPKN---

 

 

Sen1_H.s.     LHLLWVSSQQWVEAVVKCAKLPTTAFTRSSEKSSGNCSKGTAMISSLSLHSMPSNSVQLA

Sen1_M.m.     LHLLWVSSQQWVEAVVKCAKLPTTAFVRSCEKSPGSTSRGAAIMSSLALHSVQSNSVQLA

CG_7504_D.m.  ---------------GDCIELDTDTDRRS-------------------------------

YLR430W_S.c.  -----------VESLKKTFKFP--------------------------------------

 

 

Sen1_H.s.     YVQLIRSLLKEGYQLGQQSLCKRFWDK-LNLFLRGNLSLGWQLTSQETHELQSCLKQIIR

Sen1_M.m.     CVQLIRGLLKEGYQLGQQTLCKRFWDK-LNLFLRGNLSLGWQLTGQETHELQMCLKQIIR

CG_7504_D.m.  --------ISEAQKAEDPSAEREVDDE------------------EEYDESFAMSQAVIR

YLR430W_S.c.  --------LEPIFKMWYNHLSKSYHDKPLDFLLRG---------------LTMFLNKFGS

 

 

Sen1_H.s.     NIKFKAPPCNTFVDLTSACKISPASYNKEESEQMGKTSRKDMHCLEASSPTFSKEPMKVQ

Sen1_M.m.     NIKFKMPQYSTFGDSTSTFKTPPSF--KEESDKIDRKHKKNIYCLENCSPVSSKEPMKAD

CG_7504_D.m.  EMKAEMHVSDGEEDFLL-------------------------------TNGMGNLPEGSP

YLR430W_S.c.  EFWSKIEPFTFHSILDIIFN----------------------------RDSFPIKLIKIQ

 

 

Sen1_H.s.     DSVLIKADNTIEGDNNEQNYIK-DVKLEDHLLAGSCLKQSSKNIFTERAEDQIKISTRKQ

Sen1_M.m.     THRVLMKVNTTEEENFKQHYIDLNEEEQEPLPAELCLKQKSEALFSESAQEQVKISA--E

CG_7504_D.m.  SNQAYDDIVYVSDSDDDELY-------DKVADWSKLLSQKVVP-------DVIEMSQ---

YLR430W_S.c.  DNPIV--------EHQTEVYFQLTGSVTDLLSWTLPFYHALSP--SKRIQMVRKVSM---

 

 

Sen1_H.s.     KSVKEISSYTPKDCTSRNGPERGCDRGIIVSTRLLTDSSTDALEKVSTSNEDFSLKDDAL

Sen1_M.m.     KSGKESSSYAPSNSTSRNGPEWGCDRGVIMSAHSLTDSSSDFMEQVSTSNEDVSLKDGSV

CG_7504_D.m.  -------TYP------------------------LENEHKD-------SDSDLDIGAKKP

YLR430W_S.c.  AFLRIIANYPSLKSIPK-----AC----------LMNSATALLRAVLTIKEN--------

 

 

Sen1_H.s.     AKTSKRKTKVQKDEICAKLSHVIKKQHRKSTLVDNTINLDENLTVSNIESFYSRKDTGVQ

Sen1_M.m.     GKTSKPSFKLQKDEICAKLSHVIKKQIRKSTLVDNIIDLEENTAISDLEN-CSGTDGGAL

CG_7504_D.m.  KRTLRISSSSDEDSADEVIVHQTKQKGRRSKS-------------------KSPNDHVVR

YLR430W_S.c.  ----ERAMLYKNDEFETVL--------------------------------LTKTDSRAL

 

 

Sen1_H.s.     KGDGFIHNLSLD---PSGVLDDKNGEQKSQNNVLPKEKQLKNEELVIFSF-HENNCKIQE

Sen1_M.m.     KEDSIGHNVPSD---P--VLDDKHEEQKSQNSSLFK-KEIKSEELDNSSSDDEDKLQIQE

CG_7504_D.m.  QADSTTPDLPAVRKLSVSSIDSVYENKQTKLNSKLK-SCLKS------------------

YLR430W_S.c.  LNNPLIQDIIIR---SASNPNDFYPGLGAASASVAT------------------------

 

 

Sen1_H.s.     FHVDGKELIPFTEMTNASEKKSSPFKDLMTVPESRDEEMSNSTSVIYSN--LTREQAPDI

Sen1_M.m.     GRAD-DDLVSFTEVTDTLVKAPCE-GHVKMVVESRDKEMRESTALT-SN--LVEGQVPHD

CG_7504_D.m.  -----PTKTSVDNMENMTETKSCSNRQREQIVASRNEPTNICPQKIETNKTSTRKRFVST

YLR430W_S.c.  -----STMMVLAECIDFDILLLCH-RTFKLYSGKPISEIPISTNVL-----------ENV

 

 

Sen1_H.s.     SPKSDTLTDSQIDRDLHKLSLLAQASVITFPSD-SPQNSSQLQRKVKEDKRCFTANQNNV

Sen1_M.m.     SSKP-LVAGRQI--DLCNITLISQTTVIQFPSGLSKQNSFQLQ---KGDKRCLTANQNSA

CG_7504_D.m.  TSRDELSTTSKEIKDAPKNNVEPPKKML--------------------------------

YLR430W_S.c.  TNKIDL-------RSFHDGPLLAKQLLVSLK-----------------------------

 

 

Sen1_H.s.     GDTSRGQVIIISDS----DDDDDERILSLEKLTKQDKICLEREHPEQHVSTVNSKEEKNP

Sen1_M.m.     A-TCRGQVIVISDSDEEEDEDEDERSSSEENI-KQSKACIGKDCSEHRSLAVNASVEKQL

CG_7504_D.m.  --RSRSKSCYID------------RPVELDEHITKNEVPLKKKY-----ESVDNSKEELI

YLR430W_S.c.  --NINGLLIVPSNT----------AVAEAHNALNQKFLLLSTRLMEKFADILPGQLSKIL

 

 

Sen1_H.s.     VKEEKTETLFQFEESDSQCFEFESSSEVFSVWQDHP-DDNNSVQDGEKKCLAPIANTTNG

Sen1_M.m.     VKEEERYPV-EFEDSESQVFEFESSSEVFSVWQDHKIDSKNSLQGEQKSYVTHVADSTNN

CG_7504_D.m.  VTLEAPAML-------------------------------TTPTKSKTQCVKKKATQTRG

YLR430W_S.c.  ADEDASQGF----------------------W--------SCIFSSDKHLYQAATNILYN

 

 

Sen1_H.s.     Q-GCTDYVSE-VVKKGAEGIEEHTRPR-SISVEEFCEIEVKKPKRKRSEKPMAEDPVRPS

Sen1_M.m.     NLGCGDSVSEEVVRNKAEGVKEHAGPHSSVSAEEFCKTGVKKPKRKRYDKVTAEDPQRPS

CG_7504_D.m.  RRKTIH------SRDEIRSLTAEAEENKKISPAKQTNEEIPIPT----------------

YLR430W_S.c.  TFD---------VEGRLEGILAILNSNLTVNLKNINVM----------------------

 

 

Sen1_H.s.     SSVRNEGQSDTNKRDLVGNDFKSIDRRTSTPNSRIQRATTVSQKKSSKLCTCTEPIRKVP

Sen1_M.m.     SSVGTDQLPD--RRDLTESDLKSADMGMATPSSSVERDSTILQK-STKSRTHSKPVRKVP

CG_7504_D.m.  -------------------------------KSPLKRNARLLNR----------------

YLR430W_S.c.  ------------LQRLINCEF----------YEPCPRAVRVLMD---VVSAFVDPISGVF

 

 

Sen1_H.s.     VSKTPKKTHSDAKKGQNRSSNYLSCRTTPAIVPPKKFRQCPEPTSTAEKLGLKKGPRKAY

Sen1_M.m.     ASKATKKTHSDTRRGQSKSSCYISCRTSPAIVPPKKLRQCPEPTSTVEKLGLKKAPRKAF

CG_7504_D.m.  -----------------SKSCYMD-------------RLVISETEDPAKKVIKDISPTKS

YLR430W_S.c.  AN-------FQTLKSQNTEKEFLKFWESCWLFLDTIYKFTLKWASKYDYSELENFTKDTL

 

 

Sen1_H.s.     ELSQRSLDYVAQLRDHGKTVGVVDTRKKTKLISPQNLSVRNNKKLLTSQELQMQRQIRPK

Sen1_M.m.     ELSQRSLECIVQLRDHGKTVGVVDAPKKAKLISPQTLSIKNNKKLLTSQDLQFQRLMRSR

CG_7504_D.m.  DTTDNVLNFVDVRQTRGPS--VIEAPSLPK-------NRGKLRGVSAEVKVKDKVLDRQ-

YLR430W_S.c.  DLSRSLVDSFREFSD------ILHDQTKNLLLN----VLETFKNMLYWLRLSDEVLLES-

 

 

Sen1_H.s.     SQKNRRRLSDCESTDVKRAGSHTAQNSDIFVPESDRSDYNCTGGTEVLANSNRKQLIKCM

Sen1_M.m.     SHKKRD--FDYKNTDTVRV-SRIVQGSDVLEADSDEPDDHRV--SEPLAISNEKQLAKCM

CG_7504_D.m.  -----------------RF---IDYQAEMNAKWKQKPKDKKK---------EDEKLKEC-

YLR430W_S.c.  ---------------CVRL---IISTSDLAHEKHVKVDDS---------------LVEMM

 

 

Sen1_H.s.     PSEPETIKAKHGSPATDDACPLNQCDSVVLNGTVPTNEVIVSTSEDPLGGGDPTARH-IE

Sen1_M.m.     LSKTEVAEASSDPWVTGITCLVNQCESRVLSGGVPTDVVMVSASEDPVDGGAVTVQV-GE

CG_7504_D.m.  --RREALKKLSEKPKENSH------RSTTNKRKNPTS---VPTVQNTNRGGFLTKGVDGP

YLR430W_S.c.  AKYASKAKRFSNKLTEQQASEILQ-KAKIFNKALTEE---VATEAENYRKEKELSRL-GK

 

 

Sen1_H.s.     MAALKEGEPDSSSDA-EEDNLFLTQNDPEDMDLCSQMENDNYKLIELIHGKDTVEVEEDS

Sen1_M.m.     VASVKAAEPASSSDTDDDDNLFLTQHDPQDMDLCSQLEN---KTIIVAHKKDTVQ-REDS

CG_7504_D.m.  APKLAKTDNAKPPPKKP-----VPKQPPAIETFSQQLQA---ADKAVLHPQPQCS-----

YLR430W_S.c.  VIDLTDSVPASPSLSPSLSSTIASSSAESRADYLQRK-----ALSSSITGRPRVA-----

 

 

Sen1_H.s.     VSRPQLESLSGTKCKYKDCLETTKNQGEYCPKHSEVKAADEDVFRKPGLPPPASKPLRPT

Sen1_M.m.     LSRPQLESLSITKCKYKDCVETTKNQGEYCPRHSEAKAADDGLFRKPGLPLSVARPLRPT

CG_7504_D.m.  --RP----------VERKEAELARNQ----RTCNKVTFAEMELYHQKA---EDSKKLQKK

YLR430W_S.c.  --QPKITSFG----TFQSSANAKLHRTKPVKPLSKMELARMQLLNNRVVHPPSAPAFHTK

 

 

Sen1_H.s.     T-KIFSSKSTSRIAGLSKSLETSSALSPSLKNKSKGIQSILKVPQPVPLIAQKPVGEMKN

Sen1_M.m.     TTKIFSSSSASRTANLSKSLESTTLQQSALKNKSSGAQPNLKVTPPSSMGSQKPVAEVKS

CG_7504_D.m.  LRKVHFNDDV--------------KVHCIERVKGASSK-------------------VQG

YLR430W_S.c.  SRGLSNKNDDSSSEESDNDIESARELFAIAKAKGKGIQT------------------VDI

 

 

Sen1_H.s.     SCNVLHPQSPNNSNRQGCKVPFGESKYFPSSSPVNILLSSQSVSDTFVKEVLKWKYEMFL

Sen1_M.m.     LCNIFHFQTPSSSSKQSCKLTFSENRPTSAASPVNILLPSQSIFDTFIKEVLKWKYQMFL

CG_7504_D.m.  RKECIKLRLSSYRERR----EWIRR----ENKPVNDI-------RQHSRSILKWA-NQWL

YLR430W_S.c.  NGKVVKRQTAAELAKQ--ELEHMRKRLNVDMNPLYEI-------------ILQWDYTRNS

 

 

Sen1_H.s.     NFGQCGPPASLCQSISRPVPVRFHNYGDYFNVFFPLMVLNTFETVAQEWLNSPNRENFYQ

Sen1_M.m.     NFDKCGAPTSLCQSISRPVPVRFQDCAEYFNVFLPLIILNAFETVAQEWLSSPNKENFYQ

CG_7504_D.m.  KHGSVDAVAE--QDVLMPIPPEFDSFKNYREIFVPLMKLELLSTIERDY-KINNKNTFSV

YLR430W_S.c.  EYPDDEPIGNYSD-----VKDFFNSPADYQKVMKPLLLLESWQGLC----SSRDREDYKP

 

 

Sen1_H.s.     LQVRKFPADYIKYWEFAVYLEECELAKQLYP----KENDLVFLAPERINEEKKDTERNDI

Sen1_M.m.     LQLRKFPADYKKYWEFLIYLNESELAKQLHP----KENDLVFLAPEKSY-----MDRHGM

CG_7504_D.m.  SLI---------------NVETQDMCYRLVT----RVNSKPF---------------GKF

YLR430W_S.c.  FSI--IVGNRTAVSDF--YDVYASVAKQVIQDCGISESDLIVMAYLPDFRPDKRLSSDDF

 

 

Sen1_H.s.     QDLHEYHSGYVH-KFRRTSVMR--NGKT-ECYLSIQTQE-NFPA--NLNELVNCIVISSL

Sen1_M.m.     QDCSHYYCGYVH-KFRRTSVMR--SGKA-ECSLCIQTQD-TLPA--SVKNLTRCIVISSL

CG_7504_D.m.  VLYTLYCCGMLKETFANLLELKFVSGNVFDLTFEILKQDISEEKLKNIKQLTARPVVDSL

YLR430W_S.c.  KKAQHTCLAKVR-TLKNTK-----GGNV-DVTLRIHRNH-SFSKFLTLRSEIYCVKVMQM

 

 

Sen1_H.s.     VTTQRKLKAMSLLGSRNQLARAVLNPNPMDFCTKDLLTTTSERIIAYLRDFNEDQKKAIE

Sen1_M.m.     VTTQRKLKAMSLLSSRNQLARAVLNPNPMDFCTKDLLTTTSERIVAYLKDFNEDQKKAIE

CG_7504_D.m.  RVELGALSAVHQLRS-SPLCRRILKPTQT---VNEVSLPKQPFTFKGCHKLNEHQENIVL

YLR430W_S.c.  TTIEREYSTLEGLEY-YDLVGQILQAKPSPPVNVDAAEIE---TVKKSYKLNTSQAEAI-

 

 

Sen1_H.s.     TAYAMVKHSPSVAKICLIHGPPGTGKSKTIVGLL-YRLLTENQRKGH--------SDENS

Sen1_M.m.     TAYAMVKHSPSVAKICLIHGPPGTGKSKTIVGLL-YRLLTENQRKGH--------SDENF

CG_7504_D.m.  HTYQRIIDDLQ-PSLTLIQGPPGTGKSRVISELC-LQTLYGNAAKTL-------------

YLR430W_S.c.  ------VNSVSKEGFSLIQGPPGTGKTKTILGIIGYFLSTKNASSSNVIKVPLEKNSSNT

 

 

Sen1_H.s.     NAKIKQNRVLVCAPSNAAVDELMKKIILEFKEKCKDKKNPLGNCGDINLVRLGPEKSINS

Sen1_M.m.     NAKIKQNRVLVCAPSNAAVDELMKKIILEFKEKCKDKKNPLGNCGDINLVRLGPEKSINT

CG_7504_D.m.  -----DRKILICAHSNTAVDHIVGLLGSVLRVMNRDQF---------HLLRFGMHEKMSH

YLR430W_S.c.  EQLLKKQKILICAPSNAAVDEICLRLKSGVYDKQGHQFKP-------QLVRVGRSDVVNV

 

 

Sen1_H.s.     EVLKFSLDSQVNHRMKKEL------PS----HVQAMHKRKEFLDYQLDELSRQRALCRG-

Sen1_M.m.     EVLKFSLDSQVNHRMKKDL------PS----HIQEMLRRKEILDAQLDELSRQRALCRG-

CG_7504_D.m.  YSRPFSLEAHFNKAKEQKL------QRVSKENAEILKKQHNDLKDEIQQLKEKTNLTSTY

YLR430W_S.c.  AIKDLTLEELVDKRIGERNYEIRTDPELERKFNNAVTKRRE-LRGKLDSESGNPESPMS-

 

 

Sen1_H.s.     -GREIQR-----QELDENISKVSKERQELASK----IKEVQGRPQKTQSIIILESHIICC

Sen1_M.m.     -GREMQR-----QELDEHIAIVSKERQELASK----IKEVQGRPQRAQNTIILESHVICC

CG_7504_D.m.  LLQQLQQKEKKLQLISNQLSPPLTQREEF----------------EISHMCVTRANIICT

YLR430W_S.c.  -TEDISKLQLKIRELSKIINELGRDRDEMREKNSVNYRNRDLDRRNAQAHILAVSDIICS

 

 

Sen1_H.s.     TLSTSGGLLLESAFRGQGGVPFSCVIVDEAGQSCEIETLTPLIHRCNKLILVGDPKQLPP

Sen1_M.m.     TLSTSGGLLLESAFRGQGGVPFSCVIVDEAGQSCEVETLSPLIHRCNKLILVGDPKQLPP

CG_7504_D.m.  TLSSCVKLANYVDF-------FDICIVDEATQCTEPWTLLPMRFGLTHMVLVGDMQQLPA

YLR430W_S.c.  TLSGSAHDVLATM-----GIKFDTVIIDEACQCTELSSIIPLRYGGKRCIMVGDPNQLPP

 

 

Sen1_H.s.     TVISMKAQEYGYDQSMMARFCRLLEENVEH---NMISRLPILQLTVQYRMHPDICLFPSN

Sen1_M.m.     TVISMKAQEYGYDQSMMARFCKLLEENVEQ---NMIGRLPVLQLTIQYRMHPDICLFPSN

CG_7504_D.m.  VVLSKKAIDFGLSNSMFDRIQRSLQTQLDKPGSYHLMHTKLFKLSTQYRMHPEICRWPNQ

YLR430W_S.c.  TVLSGAASNFKYNQSLFVR----MEKNSSP---YL--------LDVQYRMHPSISKFPSS

 

 

Sen1_H.s.     YVYNRNLKTNRQTEAIRCSSDW----PFQPYLVFDVGDGSERRD--NDSYINVQEIKLVM

Sen1_M.m.     YVYNKNLKTNRLTESIRCSSEW----PFQPYLVFDVGDGSERRD--NDSYINVQEIKLVM

CG_7504_D.m.  YFYEDQLINAECTARFAS--------PLIPYCVINLKYTCDSNGAQNKSISNNEEARFVA

YLR430W_S.c.  EFYQGRLKDGPGMDILNK-RPWHQLEPLAPYKFFDIISGRQEQNAKTMSYTNMEEIRVAI

 

 

Sen1_H.s.     EIIK-LIKDKRKDVSFR-NIGIITHYKAQKTMIQKDLDKEFDR--KGPAEVDTVDAFQGR

Sen1_M.m.     EIIK-LIKEKRKDISFR-NIGIITHYKAQKTMIQKDLEKEFDK--KGPAEVDTVDAFQGR

CG_7504_D.m.  KLLTEMDKHMPSK---RFSYGLISPYQNQCYALSQVIPSHMN------ITPQTVDSYQGL

YLR430W_S.c.  ELVDYLFRKFDNKIDFTGKIGIISPYREQMQKMRKEFARYFGGMINKSIDFNTIDGFQGQ

 

 

Sen1_H.s.     QKDCVIVTCVRANSIQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNQLIQD

Sen1_M.m.     QKDCIIVTCVRASAVQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWYELIQD

CG_7504_D.m.  EKDVIIISNARTR----GCGFLTNYQRLNVALTRPRRCLVICGNFEDLKSVEMWRNLLDD

YLR430W_S.c.  EKEIILISCVRADDTKSSVGFLKDFRRMNVALTRAKTSIWVLGHQRSLAKSKLWRDLIED

 

 

Sen1_H.s.     AQKRGAIIKTC--------------------------DKNYR------------------

Sen1_M.m.     AQKRGAIIKTS--------------------------DPNYR------------------

CG_7504_D.m.  ARKRKVYFNLD-------------------------------------------------

YLR430W_S.c.  AKDRSCLAYACSGFLDPRNNRAQSILRKFNVPVPSEQEDDYKLPMEYITQGPDEVKSNKD

 

 

Sen1_H.s.     ----------HDAVKILKLKPVLQRSLTHPPTI---------APEGSRPQGGLPSSKLDS

Sen1_M.m.     ----------HDAMKILKLKPVLQRSLTHPPAT---------APEAPRPQGGLPSNRLDS

CG_7504_D.m.  ------------------------------------------------------------

YLR430W_S.c.  TKKRRVVDEGEEADKAVKKKKKEKKKEKKKSKADDKKKNNKKAESPSTSSGTKKKSSIFG

 

 

Sen1_H.s.     GFAKTSVAASLYHTPSDSKEITLTVTSKDPERPPV----------HDQLQDPRLLKRMGI

Sen1_M.m.     GLATTSFAASLYHTPSD------TVTSKGPERPLL----------QDRLRDPRLLRRLDA

CG_7504_D.m.  ---------------------------------------------RDDVND--LDRSLIK

YLR430W_S.c.  GMSVPSAVVPKTFPDVDSNKKAAAVVGKKKNNKHVCFSDDVSFIPRNDEPEIKVTRSLSS

 

 

Sen1_H.s.     EVKGGIF-LWDPQPSSP----------QHPGATPPTGEPGF-------------------

Sen1_M.m.     EAK-GTF-LKDPQPVSP----------QLPGVVHLLGEPGF-------------------

CG_7504_D.m.  KMMVNTINLI--------------------------------------------------

YLR430W_S.c.  VLKEKQLGLKETRTISPPEISNNEDDDDEDDYTPSISDSSLMKSEANGRNNRVASHNQNF

 

 

Sen1_H.s.     -PVVHQDLSHIQQP-AAVVAALSSHKPPVR---------------GEPP-----------

Sen1_M.m.     -PVVFQDLGFVVPPSTAIVAPLGSHRSPMQ---------------AEPP-----------

CG_7504_D.m.  ------------------------------------------------------------

YLR430W_S.c.  SASIYDDPQVSQAKQTQVPAAITKHRSSNSVLSGGSSRILTASDYGEPNQNGQNGANRTL

 

 

Sen1_H.s.     ------------------------AASPE--ASTCQSKCDDP-EEELCHRREARAFSEGE

Sen1_M.m.     ------------------------PAHPAAAASTSKRKYSDP-DAGLSHKREPRAFS-GE

CG_7504_D.m.  ------------------------------------------------------------

YLR430W_S.c.  SQHVGNANQYSTAPVGTGELHETLPAHPQ---DSYPAEAEDPYDLNPHPQPQSSAFKGPG

 

 

Sen1_H.s.     QEKCGSETHHTRRNSRWDKRTLEQEDSSSKKRKLL--

Sen1_M.m.     QGRHGSVTHHVLRSTDWDRRRL--DDSSAKRRQFL--

CG_7504_D.m.  -------------------------------------

YLR430W_S.c.  SGPTGT------RNS--SRRNASSSPFIPKKRKPRS*