S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein LGP2 LGP2
Database Links
Cellular Function Role in Innate Immune System Role in Innate Immune System

Group Alignment

Q96C10|LGP2_HUMAN      MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLV

Q99J87|LGP2_MOUSE      MELRPYQWEVILPALEGKNIIIWLPTGAGKTRAAAFVAKRHLETVDRGKVVVLVNRVHLV

                       ****.******:***********************:********** .************

 

Q96C10|LGP2_HUMAN      TQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHV

Q99J87|LGP2_MOUSE      SQHAEEFRRMLDKHWTVTTLSGDMGSRAGFGLMARSHDLLICTAELLQLALNSSEEDEHV

                       :**.******** :***********.***** :**.************:**.*.**:***

 

Q96C10|LGP2_HUMAN      ELTVFSLIVVDECHHTHKDTVYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDG

Q99J87|LGP2_MOUSE      ELREFSLIVVDECHHTHKDTVYNTILSRYLEQKLKKAEPLPQVLGLTASPGTGGATKLQG

                       **  *******************.*:*:*** **::*:*****************:**:*

 

Q96C10|LGP2_HUMAN      AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQI

Q99J87|LGP2_MOUSE      AIDHILQLCANLDTCHIMSPKNCYSQLLMHNPKPCKQYDLCQRRAQDPFGDLIKKLMNQI

                       **:*:*********  ****:** .**  *. :*****:**:**:*******:****:**

 

Q96C10|LGP2_HUMAN      HDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAV

Q99J87|LGP2_MOUSE      HQQLEMPDLKQQFGTQMYEQQVVQLCKDAAEAGLQEQRVYALHLRRYNDALFIHDTVRAR

                       *::****:*.::***********:*.: ** ********************:*******

 

Q96C10|LGP2_HUMAN      DALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPKLEMLEKILQR

Q99J87|LGP2_MOUSE      DALDMLQDFYDRERTTKTQMVRAESWLLKLFDDHKNVLGQLAARGPENPKLEMLERILLK

                       ***  *****.**:.****:: **  ** ****:** *.:**::***********:** :

 

Q96C10|LGP2_HUMAN      QFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQ

Q99J87|LGP2_MOUSE      QFGSPGHTRGIIFTRTRQTASSLLLWLRQQPCLQTVGIKPQMLIGAGNTSQSTHMTQKDQ

                       **.*.. .**********:* ******:**  ****.*:.*:******:********:**

 

Q96C10|LGP2_HUMAN      QEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYA

Q99J87|LGP2_MOUSE      QEVIQEFRDGILSLLVATSVAEEGLDIAQCNVVVRYGLLTNEISMVQARGRARAGQSVYS

                       *****:*:** *.**************.:*************************.****:

 

Q96C10|LGP2_HUMAN      FVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQR

Q99J87|LGP2_MOUSE      FLATEGSREMKRELTNEALEVLMEKAVAAVQKMDPDEFKAKIRDLQQASLVKRAARAAHR

                       *:*******:**** *****.***:*********  *::*********:*.****:**:*

 

Q96C10|LGP2_HUMAN      ENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKV

Q99J87|LGP2_MOUSE      EIQQGQFLPEHVQLLCINCMVAVGYGSDLRKVEGTHHVNVNPNFSVYYTTSQNPVVINKV

                       * *: **  ***************:******************** **..*::*******

 

Q96C10|LGP2_HUMAN      FKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVP

Q99J87|LGP2_MOUSE      FKDWRPGGTIRCSNCGEVWGFQMIYKSVTLPVLKIGSMLLETPRGKIQAKKWSRVPFSIP

                       ****:***.* * *******:*******.*****: *******:*:************:*

 

Q96C10|LGP2_HUMAN      DFDFLQHCAENLSDLSLD

Q99J87|LGP2_MOUSE      VFDILQDCTQSLSELSLD

                        **:**.*::.**:****