S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Mph1p
CG7922 FancM FancM
Database Links
Cellular Function DNA repair

Group Alignment

sp|Q8IYD8|FancM_H.S. ------------------------------------------------AY

tr|B2RX10|FancM_M.m. MSGRQRTLFQTWGPSLVRGSGDSGCGQPRSPAMAEALPEEDDEVLLVAAY

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. --------------------------------------------------

 

sp|Q8IYD8|FancM_H.S. EAERQLCLENGGFCTSAGALWIYPTNCPVRDYQLHISRAALFCNTLVCLP

tr|B2RX10|FancM_M.m. EAERQLDPGDGGFCAAAGALWIYPTNCPVRDYQLDISRSALFCNTLVCLP

sp|P40562|MPH1_S.c. --DVSFGPTHHELDYDALSFYVYPTNYEVRDYQYTIVHKSLFQNTLCAIP

tr|Q9VDA0|Q9VDA0_D.m. -------------------------------YQQTIVQSALFKNTLVVLP

** * : :** *** :*

 

sp|Q8IYD8|FancM_H.S. TGLGKTFIAAVVMYNFYRWFPSGKVVFMAPTKPLVTQQIEACYQVMGIPQ

tr|B2RX10|FancM_M.m. TGLGKTFIAAVVMYNFYRWFPSGKVVFMAPTKPLVTQQMEACFHVMGIPQ

sp|P40562|MPH1_S.c. TGMGKTFIASTVMLNYFRWTKKAKIIFTAPTRPLVAQQIKACLGITGIPS

tr|Q9VDA0|Q9VDA0_D.m. TGLGKTFIAAVVMYNFYRWYPKGKIVFMAPTRPLVSQQIHASQKIMPFPS

**:******:.** *::** ..*::* ***:***:**:.*. : :*.

 

sp|Q8IYD8|FancM_H.S. SHMAEMTGSTQASTRKEIWCSKRVLFLTPQVMVNDLSRG----ACPAAEI

tr|B2RX10|FancM_M.m. SHMAEMTGSTQAVNRKEIWSSRRVLFLTPQVMVNDLTRG----AVPATHV

sp|P40562|MPH1_S.c. DQTAILLDKSRKN-REEIWANKRVFFATPQVVENDLKRG----VLDPKDI

tr|Q9VDA0|Q9VDA0_D.m. EDTVQLTGQLPRPKRAELWASKRVFFATPQVVHSDMLEADGECSFPFGSI

.. . : .. * *:*..:**:* ****: .*: .. :

 

sp|Q8IYD8|FancM_H.S. KCLVIDEAHKALGNYAYCQVVRELVKYTNHFRILALSATPGSDIKAVQQV

tr|B2RX10|FancM_M.m. KCLVVDEAHKALGNYAYCQVVRELVKYTTHFRILALSATPGSDIKAVQQV

sp|P40562|MPH1_S.c. VCLVIDEAHRATGSSAYTNVVKFIDRFNSSYRLLALTATPASDLEGVQEV

tr|Q9VDA0|Q9VDA0_D.m. KLIVVDEAHRAKGRYAYTQVADCLMARNRYFRMLALSATPGRTMEDVAAV

:*:****:* * ** :*. : . :*:***:***. :: * *

 

sp|Q8IYD8|FancM_H.S. ITNLLIGQIELRSEDSPDILTYSHERKVEKLIVPLGEELAAIQKTYIQIL

tr|B2RX10|FancM_M.m. ITNLLIGKIELRSEESPDILPYSHERRVEKLVVPLGEELGAIQKTYIQIL

sp|P40562|MPH1_S.c. VNNLDISKIEIRTEESMDIVKYMKKRKKEKIEVPLLLEIEDIIEQLGMAV

tr|Q9VDA0|Q9VDA0_D.m. CRNLYISNLQVRWDTSIDVQPYIHRRTIRTIVVSLKERIKEPRERLLQII

** *.::::* : * *: * :.* ..: *.* .: : :

 

sp|Q8IYD8|FancM_H.S. ESFARSLIQRNVLMRRDIPNLTKYQIILARDQFRKNPSPNIVGIQQGIIE

tr|B2RX10|FancM_M.m. ETFASSLIHRNVLMKRDIPNLTKYQIILARDQFRKNPSPNIVGIQQGIIE

sp|P40562|MPH1_S.c. KPVLQQAIELGIYEECDPSQINAFKAMQQSQKIIANPT-----IPEGIKW

tr|Q9VDA0|Q9VDA0_D.m. EPYLRQLMEAEIFKGNK-GTVSRNSLLFEQKSFVERSAQGQRHPDHNIIM

:. . :. : . :. . : ..: ..: ..*

 

sp|Q8IYD8|FancM_H.S. GEFAICISLYHGYELLQQMGMRSLYFFLCGIMDGTKGMTRSKNELGRNED

tr|B2RX10|FancM_M.m. GEFALCISLYHGYELLQQMGMRSLYFFLSGIMDGTKGMTRARNELSRNED

sp|P40562|MPH1_S.c. RNFFILQLLNNVGQMLKRLKIYGIRTFFNYFQNKCTEFTTKYN-LKKSTN

tr|Q9VDA0|Q9VDA0_D.m. GNFAMCISMYHSLDLMERHGLRVFVNNFDADDDGREKFVLARDGNLRNLV

:* : : : ::::: : : : : :. : :.

 

sp|Q8IYD8|FancM_H.S. FMKLYNHLECMFARTRSTSANGISAIQQGDKNKKFVYSHPKLKKLEEVVI

tr|B2RX10|FancM_M.m. FMKLYTHLQSAFAPASTSDAS---AFQRGNKEKKFVYSHPKLKKLEEVIL

sp|P40562|MPH1_S.c. KIAAEFYYHPILKNIKNQCEN--------YLSDPKFVGHGKLQCVRDELM

tr|Q9VDA0|Q9VDA0_D.m. EQVRQELGANPLDYTTHAMTNG----EVPPLPSDLDFGHAKYEKLRQVLV

: . . .* * : :.: ::

 

sp|Q8IYD8|FancM_H.S. EHFKSWNAENTTEKKRDETRVMIFSSFRDSVQEIAEMLSQHQP-IIRVMT

tr|B2RX10|FancM_M.m. EHFKSWNAKATTEKKCHESRVMIFSSFRDSVEEIAEMLLQHRP-VIRVMT

sp|P40562|MPH1_S.c. DFFQ---------KRGSDSRVIIFTELRESALEIVKFIDSVADDQIRPHI

tr|Q9VDA0|Q9VDA0_D.m. QHFQ----------ANPDSRAIVFCEYRESVMLIHRLLLQHRP-VLRPRC

:.*: ::*.::* . *:*. * .:: . :*

 

sp|Q8IYD8|FancM_H.S. FVGHAS--------------------------------------------

tr|B2RX10|FancM_M.m. FVGHAS--------------------------------------------

sp|P40562|MPH1_S.c. FIGQAR-AKEGFDEVKYTRKHAPKGRKKVERLHRQEQEKFLEAERTKRAA

tr|Q9VDA0|Q9VDA0_D.m. FVGQGST-------------------------------------------

*:*:.

 

sp|Q8IYD8|FancM_H.S. --------------------------------------------------

tr|B2RX10|FancM_M.m. --------------------------------------------------

sp|P40562|MPH1_S.c. RAANDKLERSA---------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. --------------------------------------------------

 

sp|Q8IYD8|FancM_H.S. -------GKSTKGFTQKEQLEVVKQFRDGGYNTLVSTCVGEEGLDIGEVD

tr|B2RX10|FancM_M.m. -------GKNTKGFTQKEQLQVVRQFRDGGYNTLVSTCVGEEGLDIGEVD

sp|P40562|MPH1_S.c. RRTGSSEEAQISGMNQKMQKEVIHNFKKGEYNVLVCTSIGEEGLDIGEVD

tr|Q9VDA0|Q9VDA0_D.m. -------VGASYALTQKQQLQIMTDFRSGTSNVLVATSIGEEGLDVGEVE

** * . *: * * ** * ******.***:

 

sp|Q8IYD8|FancM_H.S. LIICFDSQ-KSPIRLVQRMGRTGRKRQGRIVIILSEGREERIYNQSQSNK

tr|B2RX10|FancM_M.m. LIICFDAQ-KSPIRLIQRMGRTGRKRQGRIVVILAEGREERTYNQSQSNK

sp|P40562|MPH1_S.c. LIICYD--TTSSPIKNQRMGRTGRKRDGKIVLLFSSNESYKKFERAMEDY

tr|Q9VDA0|Q9VDA0_D.m. MIVCFDICSTNPTRFIQRIGRTGRKKNGEVVMLVTEGREQQVLKDVLANK

*:*:* . ** ******: .:* :

 

sp|Q8IYD8|FancM_H.S. -RSIYKAISSNRQVLHFYQRSPRMVPDGINPKLHKMFITHGVYEPEKPSR

tr|B2RX10|FancM_M.m. -KNIYKAISGNRQVLRLYQGSPRMVPDKINPELHKMYITHGVYEPEK-AR

sp|P40562|MPH1_S.c. -ISTLQALISKQCI-DYKKSDRIIPEDIIPECHETLITI-NDENEI-IN

tr|Q9VDA0|Q9VDA0_D.m. DQINKKLLNSSVVKLSLYEQNPRMVPSKFQPKCEEKHMEP----------

: * *.:* *

 

sp|Q8IYD8|FancM_H.S. NLQRKSSIFSYRDGMRQSSLKKDWFLSEEEFKLWNRLYRLRDSDEIKEIT

tr|B2RX10|FancM_M.m. SVQRRP--FSSRGGIKASKSNKDGLLSEEEFNLWSRLYRLGDSDQVKGVA

sp|P40562|MPH1_S.c. EMEDVDEVIR----------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. --------------------------------------------------

 

sp|Q8IYD8|FancM_H.S. LPQVQFSSLQNEENKPAQESTTGIHQLSLSEWRLWQDHPLPTHQVDHSDR

tr|B2RX10|FancM_M.m. LPQSHFPSLQ--EDRVIQDPTTRIHQLSLSEWSLWQDRPLPTHQVDHSDR

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. -----VAEEKPKPKSAAKTKESRKRKQPVAQTGSLRKYFKESPPTESQQG

 

 

sp|Q8IYD8|FancM_H.S. CRHFIGLMQMIEGMRHEEGECSYELEV--ESYLQMEDVTSTFIAPRNESN

tr|B2RX10|FancM_M.m. CHHFISIMKMIEGMRHEEGECSYELKI--RPFLQMEDVCSKYHAPRNGYN

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. ILQGIKPYQMSEASQQLVKQQVLRRSVTLKNFFGESQASSTLTSSQEDVQ

 

 

sp|Q8IYD8|FancM_H.S. NLASDTFITHKKSSFIKNINQGSSSSVIESDEECAEIVKQTHIKPTKIVS

tr|B2RX10|FancM_M.m. NVASVASSAHQKSSFRPSVDAGGSLTVIESEEEHADTVKQRDSKWTKITS

sp|P40562|MPH1_S.c. -------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. RLRKLTRLLQSSKPFVSDSKD-----------------------------

 

 

sp|Q8IYD8|FancM_H.S. LKKKVSKEIKK----DQLKKENNHGIIDSVDNDRNSTVENIFQEDLPNDK

tr|B2RX10|FancM_M.m. LREKPCRAGRKGQTCEHSEGEGEDGDAGSSDADGQSPAEADSQVDPPSGE

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. --------------------------------------------------

 

sp|Q8IYD8|FancM_H.S. RTSDTDEIAATCTINENVIKEPCVLLTECQFTNKSTSSLAGNVLDSGYNS

tr|B2RX10|FancM_M.m. RMADVGGISILGAVTE-EDNHPGTLQMECQVTNKSCARYS---LDSGYSS

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. -------------------------------------------LMSHLQD

 

sp|Q8IYD8|FancM_H.S. FNDEKSVSSNLFLPFEEELYIVRTDDQFYNCHSLTKEVLANVERFLSYSP

tr|B2RX10|FancM_M.m. FSDEKSVSSNLFLPLEEELFTDRAAEQFYNCRPMTEDVLANVERFLSRSP

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. DHLPRQIKLYLLKSNPEFLRETHLKMQVQSELNIADDRLNSRQRRTKNNY

 

 

sp|Q8IYD8|FancM_H.S. PPLSGLSDLEYEIAKGTALENLLFLPCAEHLRSDKCTCLLSHSAVNSQQN

tr|B2RX10|FancM_M.m. PSLSGLSDLVYDVTQGCEFDNASCSPYPEHEHSPRPVSPASHSAGNSQQN

sp|P40562|MPH1_S.c. ------------------------------------------YATQCMMG

tr|Q9VDA0|Q9VDA0_D.m. QLLLDICDG---------------------------------MDQMNELL

 

sp|Q8IYD8|FancM_H.S. LELNSLKCINYPSEKSCLYDIPNDNISDEPSLCDCDVHKHNQN-ENLVPN

tr|B2RX10|FancM_M.m. LESNSAKRISHPTEKYCLPGTTHNKVSDRPSFCESDSEGHNIKYQNSGSN

sp|P40562|MPH1_S.c. KKVKPKKAITK--------------------------------------K

tr|Q9VDA0|Q9VDA0_D.m. QGDNSGAEISFRDELNPIYNQSPKKFDTICEQIFDGLNEHGLNSNNFELK

:. *. :

 

sp|Q8IYD8|FancM_H.S. NRVQIHRSPAQNLVGENNHDVDNSDLPVLSTDQDESLLLFEDVNT-----

tr|B2RX10|FancM_M.m. SCAQIQADLENNFVDKNSHDD--SEPPVLFTDEDESLLLFEDDFKNIEDG

sp|P40562|MPH1_S.c. KRVQENKKPKKFFMPDNVETSIVSASTLINKFLVN---------------

tr|Q9VDA0|Q9VDA0_D.m. QDLLEKLELRNLETTVNEQLG-----------------------------

. : . : *

 

sp|Q8IYD8|FancM_H.S. --EFDDVSLSPLNSKSESLPVSDKTAISETPLVSQFLISDELLLDNNSEL

tr|B2RX10|FancM_M.m. SEELNGASLPPFNSISQPLRVSGKTLTSEMPPVSHFLISDELLLDDDSEP

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. -------GIEASWSEEEWDQQEEDVKFESMYLSQQLNLPDANVVPHSSTP

 

 

sp|Q8IYD8|FancM_H.S. QDQITRDANSFKSRDQRGVQEEKVKNHEDIFDCSRDLFSVTFDLGF-CSP

tr|B2RX10|FancM_M.m. EDQIVCGAKSWKCQEGVEDGQEELRTDGQTFDCSVDLFSVTFDLGFRCSS

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. LRVKPLSKLMFKTLQGDIEEEYHSGMEASELGDNLGRLNSLMNASE----

 

sp|Q8IYD8|FancM_H.S. DSDDEILEHTSDSNRPL--DDLYGRYLEIKEISDANYVSNQALIPRDHSK

tr|B2RX10|FancM_M.m. GSDDEMLAGASDRTRTLGAADVSGRHSD-KEIKDAGGAS--GPLGRAISP

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. --------------------------------------------------

 

sp|Q8IYD8|FancM_H.S. NFTSGTVIIPSNEDMQNPNYVHLPLSAAKNEELLSPGYSQFSLPVQKKVM

tr|B2RX10|FancM_M.m. --------IPTETAQWSP--------WAQNKEYAS-FHVASSSPVKQRVR

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. --------------------------------------------------

 

sp|Q8IYD8|FancM_H.S. STPLSKSNTLNSFSKIRKEILKTPDSSKEKVNLQRFKEALNSTFDYSEFS

tr|B2RX10|FancM_M.m. STPLSKSHAS---SKTGAHMLKTLDSTKEKAGGQGFKMALNPRLGHLGFS

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. --------------------------------------------------

 

sp|Q8IYD8|FancM_H.S. LEKSKSSGPMYLHKSCHSVEDGQLLTSNESEDDEIFRRKVKRAKGNVLNS

tr|B2RX10|FancM_M.m. VEETKSSDQVFVHQSPRRTEVEHLTS--ESEDD-VFLRKTKKPKRNVLKS

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. --------------------------------------------------

 

sp|Q8IYD8|FancM_H.S. PEDQKNSEVDSPLHAVKKRRFPINRSELSSSD-ESENFPKPCSQLEDFKV

tr|B2RX10|FancM_M.m. PEDQKNNEVDSPIHAVKKPR--VLRSELASSDDESENFGRTCPRLEHFKG

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. --------------------------------------------------

 

sp|Q8IYD8|FancM_H.S. CNGNARRGIKVPKRQSHLKHVARKFLDDEAELSEEDAEYVSSDENDESEN

tr|B2RX10|FancM_M.m. RNRNIRKGSAAQKNRSQVKTMARRFLDDEAEVSGEDVDCVSADEEDESEN

sp|P40562|MPH1_S.c. -----ESGGKQLVTSNENPSKKRKIFKALDNLENDSTEEASSSLETEDEE

tr|Q9VDA0|Q9VDA0_D.m. --SKIKATERIAPIPVVDSTIETNHFPAVEESQRSTPISIADSSGESNHC

. . : : . . : . ...

 

sp|Q8IYD8|FancM_H.S. EQDSSLLDFLNDETQLSQAINDSEMRAIYMKSLRSPMMNNKYKMIHKTHK

tr|B2RX10|FancM_M.m. EQDSSLLDFVNDRTQLSQAINDSEMRAIYMKSVRSPLMSTKYRMVREKRP

sp|P40562|MPH1_S.c. VSDDNNVFIAEGQNGCQKDLETAIIRTGESLTTLKPLHNFERPNMALFVN

tr|Q9VDA0|Q9VDA0_D.m. AVNKNSEIYPMSIDETKVEVKSSLNLKMHAESIVEDLDIDLDDFLEPMDK

:.. . . :: : : . : :

 

sp|Q8IYD8|FancM_H.S. NINIFSQIPEQDETYLEDSFCVDEEESCK----GQSSEEEVCVD-FNLIT

tr|B2RX10|FancM_M.m. NMNIFSQIPEQDENYLEDSFCVDEEESCK----SQSSEEEISVD-FNLTK

sp|P40562|MPH1_S.c. DCGLPTKIEKNVKDIRGNQHNLEKEKSCT----VDKNNMVLSLDDWNFFR

tr|Q9VDA0|Q9VDA0_D.m. ELELASQTKGKSQENIVDHQMEKLEKNCEQKETAHNNDLDLTDEDLKEFL

: : :: : : : . *:.* ...: : : :

 

sp|Q8IYD8|FancM_H.S. DDCFANSKKYKTRRAVMLKEM-MEQNCAHSKKKLSRIILPDDSSEEENNV

tr|B2RX10|FancM_M.m. DSFTDEDIRYKTRYAVKIKQMNKKQNYTRPRKKLSRIILPDDDSSEEENI

sp|P40562|MPH1_S.c. NRYIPEGVSFDVEPNFVQYTKGVKVPHCHKVSKIITLFNDESNDNKKRTI

tr|Q9VDA0|Q9VDA0_D.m. EPMVEEVELMSQKKANDFKDFLEPMPEELELMSQQKKNILLPSTETIKNS

: : . . . . . ..

 

sp|Q8IYD8|FancM_H.S. NDKRESNIAVNPSTVKKNKQQDHCLNSVPSGSSAQSKVRSTPRVNPLAKQ

tr|B2RX10|FancM_M.m. PKDREHSVAGG-HAAAEHTQQGQLWASGPSGSSVPPQVLSDPSWNQSSRQ

sp|P40562|MPH1_S.c. DMNYTKCLARG-------------------------MLRDEKKFVKVNDK

tr|Q9VDA0|Q9VDA0_D.m. ENKNSHEDGSR--------------------TVSPDIFGSDSMSPLKPQG

. . . .

 

sp|Q8IYD8|FancM_H.S. SKQTSLNLKDTISEVSDFKPQNHNEVQSTTPPFTTVDSQKDCRKFPVPQK

tr|B2RX10|FancM_M.m. RLQVQPSITDAVPRTLNVKAQSHNKIKSASPPCTGVESRKEYGNHPVQLK

sp|P40562|MPH1_S.c. SQVDNNSVNHDSSQSFTLSNAELDDILGSDSDF-----------------

tr|Q9VDA0|Q9VDA0_D.m. KSLAAKLAAKAAAKVLPCPPPNSVGLNSPENRKRTNPSIQEKSPSIFDLY

. .. . : ..

 

sp|Q8IYD8|FancM_H.S. DGSALEDSSTSGASCSKSRPHLAGTHTSLRLPQEGKGTCILVGGHEITSG

tr|B2RX10|FancM_M.m. AD-SQEHSDTSAAPCSTSLLHVAEGHTAPRHLQEGNRACILVDSREITTG

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. LNRMRGRGRLAKAAENLHRITSTNPTISVPKDEEDSPIARRPSKRKIVIS

 

sp|Q8IYD8|FancM_H.S. LEVISSLRAIHGLQVEVCPLNGCDYIVSNRMVVERRSQSEMLNSVNKNKF

tr|B2RX10|FancM_M.m. LEVISSLRTVHGLQVEICPLNGCDYIVSSRMVVVRRSQSEMLSNTSKNKF

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. SDEEEEQKPQIAETQVDCESDDYERILDTQMPDPRKTPTRPRHKRSK---

 

sp|Q8IYD8|FancM_H.S. IEQIQHLQSMFERICVIVEKDREKTGDTSRMFRRTKSYDSLLTTLIGAGI

tr|B2RX10|FancM_M.m. IEQMQRLQSMFQRICVIVEKDREKAGDTSKKFRRTKCYDSLLTALVGAGI

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. -------------FNSFILDEAEKSGSDHEEEGETTIGTYLKDSMIVS--

 

sp|Q8IYD8|FancM_H.S. RILFSSCQEETADLLKELSLVEQRKNVGIHVPTVVNSNKSEALQFYLSIP

tr|B2RX10|FancM_M.m. RILFSSGQEETADLLKELSLVEQRKNAGIHIPAVLNTSKLEALPFYLSIP

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. ------SDDEDHNDTNTHAIYLRALKSPIQRPGAFKMPPPRVFRDESHIF

 

sp|Q8IYD8|FancM_H.S. NISYITALNMCHQFSSVKRMANSSLQEISMYAQVTHQKAEEIYRYIHYVF

tr|B2RX10|FancM_M.m. GISYITALNMCHQFSSVKKMANSSPEEISTCAQVNHQKAEEIYKYIHYIF

sp|P40562|MPH1_S.c. --------------------------------------------------

tr|Q9VDA0|Q9VDA0_D.m. SQPVEDDSSQYMQCSFIVDDESSTIERGHDVSECPLEKAERILKERRKQR

 

sp|Q8IYD8|FancM_H.S. DIQMLPNDLNQDRLKSDI--------------

tr|B2RX10|FancM_M.m. DMQMLPNDLNQERQKPDTCLTLGVAMKELS--

sp|P40562|MPH1_S.c. --------------------------------

tr|Q9VDA0|Q9VDA0_D.m. RLGKVPSAPVNKRRRLQTISTSSDEDDVVLID