S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Dicer1
K12H4.8
Dicer1
CG4792
Dicer1 Dicer1
Database Links
Protein Dicer2
CG6493
Database Links
Cellular Function mi RNA processing mi RNA processing mi RNA processing mi RNA processing

Dicer Group Alignment

Q9UPY3|DICER_HUMAN.      MAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGK

Q8R418|DICER_MOUSE.      MAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGK

Q9VCU9|DCR1_DROME.       -----------------MAFHWCDNNLHTTVFTPRDFQVELLATAYERNTIICLGHRSSK

P34529|DCR1_CAEEL.       ---------------------MVRVRADLQCFNPRDYQVELLDKATKKNTIVQLGTGSGK

A1ZAW0|DCR2_DROME.       --------------------------MEDVEIKPRGYQLRLVDHLTKSNGIVYLPTGSGK

                                                    .    .** :*:.*:    . * *: *   *.*

 

Q9UPY3|DICER_HUMAN.      TFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVN

Q8R418|DICER_MOUSE.      TFIAVLLTKELAHQIRGDLNPHAKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSDLEVN

Q9VCU9|DCR1_DROME.       EFIALKLLQELSRRAR----RHGRVSVYLSCEVGTSTEPCSIYTMLTHLTDLRVWQEQPD

P34529|DCR1_CAEEL.       TFIAVLLLKEYGVQLFAPLDQGGKRAFFVVEKVNLVEQQAIHIEVHTSFKVGQVHGQTSS

A1ZAW0|DCR2_DROME.       TFVAILVLKRFSQDFDKPIESGGKRALFMCNTVELARQQAMAVRRCTNFKVGFYVGEQGV

                          *:*: : :. .          .: :.::   .    :        : :.         

 

Q9UPY3|DICER_HUMAN.      ASWTK-ERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAI-LDHPYRE

Q8R418|DICER_MOUSE.      ASWTK-ERWSQEFTKHQVLIMTCYVALTVLKNGYLSLSDINLLVFDECHLAI-LDHPYRE

Q9VCU9|DCR1_DROME.       MQIP----FDHCWTDYHVSILRPEGFLYLLETRELLLSSVELIVLEDCHDSA-VYQRIRP

P34529|DCR1_CAEEL.       GLWDSKEQCDQFMKRHHVVVITAQCLLDLIRHAYLKIEDMCVLIFDECHHALGSQHPYRS

A1ZAW0|DCR2_DROME.       DDWTR-GMWSDEIKKNQVLVGTAQVFLDMVTQTYVALSSLSVVIIDECHHGT-GHHPFRE

                                  ..  .  :* :      * ::    : :..: ::::::** .    :  *

 

Q9UPY3|DICER_HUMAN.      IMK---LCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDR

Q8R418|DICER_MOUSE.      IMK---LCESCPSCPRILGLTASILNGKCDPEELEEKIQKLERILRSDAETATDLVVLDR

Q9VCU9|DCR1_DROME.       LFENHIMPAPPADRPRILGLAGPLHSAGCELQQLSAMLATLEQSVLCQIETASDIVTVLR

P34529|DCR1_CAEEL.       IMVDYKLLKKDKPVPRVLGLTASLIKAKVAPEKLMEQLKKLESAMDSVIETASDLVSLSK

A1ZAW0|DCR2_DROME.       FMR-LFTIANQTKLPRVVGLTGVLIKG-NEITNVATKLKELEITYRGNIITVSDTKEMEN

                         ::            **::**:. : ..     ::   :  **        *.:*   : .

 

Q9UPY3|DICER_HUMAN.      YTSQPCEIVVDCGPFT---------DRSGLYERLLMELEEALNFIN--DCNISVHSKERD

Q8R418|DICER_MOUSE.      YTSQPCEIVVDCGPFT---------DRSGLYERLLMELEAALDFIN--DCNVAVHSKERD

Q9VCU9|DCR1_DROME.       YCSRPHEYIVQCAPFEMDELSLVLADVLNTHKSFLLDHRYDPYEIYGTDQFMDELKDIPD

P34529|DCR1_CAEEL.       YGAKPYEVVIICKDFEIG------CLGIPNFDTVIEIFDETVAFVN--TTTEFHPDLDLD

A1ZAW0|DCR2_DROME.       VMLYATKPTEVMVSFP--------HQEQVLTVTRLISAEIEKFYVSLDLMNIGVQPIRRS

                             . :       *                   :         :              .

 

Q9UPY3|DICER_HUMAN.      STLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQE-ELHRKFLLFTDTFLR

Q8R418|DICER_MOUSE.      STLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQE-ELHRKFLLFTDTLLR

Q9VCU9|DCR1_DROME.       PKVDPLNVINSLLVVLHEMGPWCTQRAAHHFYQCNEKLKVKTPH-ERHYLLYCLVSTALI

P34529|DCR1_CAEEL.       PRRPIKDSLKTTRAVFRQLGPWAAWRTAQVWEKELGKIIKSQVLPDKTLRFLNMAKTSMI

A1ZAW0|DCR2_DROME.       KSLQCLRDPSKKSFVKQLFNDFLYQMKEYGIYAASIAIISLIVEFDIKRRQAETLSVKLM

                                  .    *   :. :                       :         .. :

 

Q9UPY3|DICER_HUMAN.      KIHALCEEHFS--------PASLDLKFVTPKVIKLLEILRKYKPYE--------------

Q8R418|DICER_MOUSE.      KIHALCEEYFS--------PASLDLKYVTPKVMKLLEILRKYKPYE--------------

Q9VCU9|DCR1_DROME.       QLYSLCEHAFHRHLGSGSDSRQTIERYSSPKVRRLLQTLRCFKPEEVHTQADGLRRMRHQ

P34529|DCR1_CAEEL.       TIKRLLEPEMK--------------------KIKSIEALRPYVPQR--------------

A1ZAW0|DCR2_DROME.       HRTALTLCEKIR-----------------HLLVQKLQDMTYDDDDD--------------

                             *                            : :: :                    

 

Q9UPY3|DICER_HUMAN.      ------------------------------RQQFESVEWYNNRNQDNYVSWSDSEDDDED

Q8R418|DICER_MOUSE.      ------------------------------RQQFESVEWYNNRNQDNYVSWSDSEDDDDD

Q9VCU9|DCR1_DROME.       VDQADFNRLSHTLESKCRMVDQMDQPPTETRALVATLEQILHTTEDRQTNRSAARVTPTP

P34529|DCR1_CAEEL.       -----------------------------VIRLFEILETFNPEFQKERMKLEKAEH----

A1ZAW0|DCR2_DROME.       ----------------------------NVNTEEVIMNFSTPKVQRFLMSLKVSFADKDP

                                                             ::      :    . . :     

 

Q9UPY3|DICER_HUMAN.      EEIEEKEKPE--TNFPSPFTN-----------------ILCGIIFVERRYTAVVLNRLIK

Q8R418|DICER_MOUSE.      EEIEEKEKPE--TNFPSPFTN-----------------ILCGIIFVERRYTAVVLNRLIK

Q9VCU9|DCR1_DROME.       TPAHAKPKPSSGANTAQPRTRRRVYTRRHHRDHNDGSDTLCALIYCNQNHTARVLFELLA

P34529|DCR1_CAEEL.       ---------------------------------------LSAIIFVDQRYIAYSLLLMMR

A1ZAW0|DCR2_DROME.       KD-------------------------------------ICCLVFVERRYTCKCIYGLLL

                                                                :. ::: ::.: .  :  ::

 

Q9UPY3|DICER_HUMAN.      EAGKQDPELA-YISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSI

Q8R418|DICER_MOUSE.      EAGKQDPELA-YISSNFITGHGIGKNQPRSKQMEAEFRKQEEVLRKFRAHETNLLIATSV

Q9VCU9|DCR1_DROME.       EISRRDPDLK-FLRCQYTTDR-VADPTTEPKEAELEHRRQEEVLKRFRMHDCNVLIGTSV

P34529|DCR1_CAEEL.       HIKSWEPKFK-FVNPDYVVGASGRNLAS--SDSQGLHKRQTEVLRRFHRNEINCLIATSV

A1ZAW0|DCR2_DROME.       NYIQSTPELRNVLTPQFMVGR---NNISPDFESVLERKWQKSAIQQFRDGNANLMICSSV

                         .     *.:   :  :: ..    .  .   :     : * ..:::*:  : * :* :*:

 

Q9UPY3|DICER_HUMAN.      VEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYIMLAD----------------

Q8R418|DICER_MOUSE.      VEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAPISNYVMLAD----------------

Q9VCU9|DCR1_DROME.       LEEGIDVPKCNLVVRWDPPTTYRSYVQCKGRARAAPAYHVILVAPSYKSPTVGSVQLTDR

P34529|DCR1_CAEEL.       LEEGVDVKQCNLVIKFDRPLDMRSYVQSKGRARRAGSRYVITVE----------------

A1ZAW0|DCR2_DROME.       LEEGIDVQACNHVFILDPVKTFNMYVQSKGRARTTEAKFVLFTADKER------------

                         :***:*:  ** *.  *     . ***.***** . : .:: .                

 

Q9UPY3|DICER_HUMAN.      ------------------------------------------------------------

Q8R418|DICER_MOUSE.      ------------------------------------------------------------

Q9VCU9|DCR1_DROME.       SHRYICATGDTTEADSDSDDSAMPNSSGSDPYTFGTARGTVKILNPEVFSKQPPTACDIK

P34529|DCR1_CAEEL.       ------------------------------------------------------------

A1ZAW0|DCR2_DROME.       ------------------------------------------------------------

                                                                                    

 

Q9UPY3|DICER_HUMAN.      ------------------------------------------------------------

Q8R418|DICER_MOUSE.      ------------------------------------------------------------

Q9VCU9|DCR1_DROME.       LQEIQDELPAAAQLDTSNSSDEAVSMSNTSPSESSTEQKSRRFQCELSSLTEPEDTSDTT

P34529|DCR1_CAEEL.       ------------------------------------------------------------

A1ZAW0|DCR2_DROME.       ------------------------------------------------------------

                                                                                    

 

Q9UPY3|DICER_HUMAN.      ---------TDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETDIDPVMDDDDVFPPYVL

Q8R418|DICER_MOUSE.      ---------TDKIKSFEEDLKTYKAIEKILRNKCSKSADGAEADVHAGVDDEDAFPPYVL

Q9VCU9|DCR1_DROME.       AEIDTAHSLASTTKDLVHQMAQYREIEQMLLSKCAN-TEPPEQEQSEAERFSACLAAYRP

P34529|DCR1_CAEEL.       ------------------------------------------------------------

A1ZAW0|DCR2_DROME.       ---------EKTIQQIYQYRKAHNDIAEYLKDRVLEKTEPELYEIKG------HFQDDID

                                                                                    

 

Q9UPY3|DICER_HUMAN.      RPDDG-GPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPDG----------TFYS

Q8R418|DICER_MOUSE.      RPDDG-GPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPDG----------TFYS

Q9VCU9|DCR1_DROME.       KPHLLTGASVDLGSAIALVNKYCARLPSDTFTKLTALWRCTRNERAG-------VTLFQY

P34529|DCR1_CAEEL.       ---------------EKDTAAYCSKLPSDIFTRLVPHNQIIPIEENG-------VTKYCA

A1ZAW0|DCR2_DROME.       PFTNENGAVLLPNNALAILHRYCQTIPTDAFGFVIPWFHVLQEDERDRIFGVSAKGKHVI

                                              **  :*:* *  : .  :                  . 

 

Q9UPY3|DICER_HUMAN.      TLYLPINSPLRASIVGP-PMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKET----V

Q8R418|DICER_MOUSE.      TLYLPINSPLRASIVGP-PMDSVRLAERVVALICCEKLHKIGELDEHLMPVGKET----V

Q9VCU9|DCR1_DROME.       TLRLPINSPLKHDIVGL-PMPTQTLARRLAALQACVELHRIGELDDQLQPIGKEG----F

P34529|DCR1_CAEEL.       ELLLPINSPIKHAIVLKNPMPNKKTAQMAVALEACRQLHLEGELDDNLLPKGRES----I

A1ZAW0|DCR2_DROME.       SINMPVNCMLRDTIYSD-PMDNVKTAKISAAFKACKVLYSLGELNERFVPKTLKERVASI

                          : :*:*. ::  *    **     *.  .*: .*  *:  ***::.: *   :     .

 

Q9UPY3|DICER_HUMAN.      KYEE------ELDLHDEEETSVPG--RPGSTKRRQCYPKAIPECLRDSYPRPDQPCYLYV

Q8R418|DICER_MOUSE.      KYEE------ELDLHDEEETSVPG--RPGSTKRRQCYPKAIPECLRESYPKPDQPCYLYV

Q9VCU9|DCR1_DROME.       RALEPDWECFELEPEDEQIVQLSDEPRPGTTKRRQYYYKRIASEFCDCRPVAGAPCYLYF

P34529|DCR1_CAEEL.       AKLL------EHIDEEPDEYAPGIAAKVGSSKRKQLYDKKIARALNESFVEADKECFIYA

A1ZAW0|DCR2_DROME.       AD-------VHFEHWNKYGDSVTATVNKADKSKDRTYKTECPLEFYDALPRVGEICYAYE

                                   .    :          . . ..: : * .  .  : :.    .  *: *

 

Q9UPY3|DICER_HUMAN.      IGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELK

Q8R418|DICER_MOUSE.      IGMVLTTPLPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELK

Q9VCU9|DCR1_DROME.       IQLTLQCPIPEEQNTRGRKIYPPEDAQQGFGILTTKRIPKLSAFSIFTRSGEVKVSLELA

P34529|DCR1_CAEEL.       FELERFREAELTLNPKRRKFEDPFNYEYCFGFLSAKEIPKIPPFPVFLRQGNMKVRLIVA

A1ZAW0|DCR2_DROME.       IFLEPQFESCEYTEHMYLNLQTP----RNYAILLRNKLPRLAEMPLFSNQGKLHVRVANA

                         : :          :    ::  *      :.:*  : :*::. :.:: ..*:: : :  

 

Q9UPY3|DICER_HUMAN.      KSGFMLS-LQMLELITRLHQYIFSHILRLEKP-ALEFK-PTDADSAYCVLPLNVVNDSST

Q8R418|DICER_MOUSE.      KSGFTLS-QQMLELITRLHQYIFSHILRLEKP-ALEFK-PTGAESAYCVLPLNVVNDSGT

Q9VCU9|DCR1_DROME.       KERVILT-SEQIVCINGFLNYTFTNVLRLQKF-LMLFD-PDSTENCVFIVPT-VKAPAGG

P34529|DCR1_CAEEL.       PKKTTVT-AAQLQEIQLFHNYLFTQVLQMCKTGNLEFDGTSNAPLNTLIVPLNKRKDDMS

A1ZAW0|DCR2_DROME.       PLEVIIQNSEQLELLHQFHGMVFRDILKIWHP-FFVLD-RRSKENSYLVVPLILGAGE-Q

                              :     :  :  :    * .:*:: :   : :.   .      ::*        

 

Q9UPY3|DICER_HUMAN.      LDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVAD

Q8R418|DICER_MOUSE.      LDIDFKFMEDIEKSEARIGIPSTKYSKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVAD

Q9VCU9|DCR1_DROME.       KHIDWQFLELIQANGNTMPR-AVPDEERQAQPFDPQRFQDAVVMPWYRNQDQPQYFYVAE

P34529|DCR1_CAEEL.       YTINMKYVSEVVANMENMPR-IPKDEVRRQYKFNAEDYKDAIVMPWYRNLEQPVFYYVAE

A1ZAW0|DCR2_DROME.       KCFDWELMTNFRRLPQSHGS--NVQQREQQPAPRPEDFEGKIVTQWYANYDKP--MLVTK

                           :: : :  .                .       : ::. ::   * * ::*    *:.

 

Q9UPY3|DICER_HUMAN.      VYTDLTPLSKFP-SPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQK

Q8R418|DICER_MOUSE.      VYTDLTPLSKFP-SPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQK

Q9VCU9|DCR1_DROME.       ICPHLSPLSCFP-GDNYRTFKHYYLVKYGLTIQNTSQPLLDVDHTSARLNFLTPRYVNRK

P34529|DCR1_CAEEL.       ILPEWRPSSKFP-DTHFETFNEYFIKKYKLEIYDQNQSLLDVDFTSTRLNLLQPRIQNQP

A1ZAW0|DCR2_DROME.       VHRELTPLSYMEKNQQDKTYYEFTMSKYGNRIG---------DVVHKDKFMIEVRDLTEQ

                         :  .  * * :  . . .*: .:   **   :          * .     ::  *  ..

 

Q9UPY3|DICER_HUMAN.      GKALPLSSA---EKRKAKWESLQ-------------NKQILVPELCAIHPIPASLWRKAV

Q8R418|DICER_MOUSE.      GKALPLSSA---EKRKAKWESLQ-------------NKQILVPELCAIHPIPASLWRKAV

Q9VCU9|DCR1_DROME.       GVALPTSSE---ETKRAKRENLE-------------QKQILVPELCTVHPFPASLWRTAV

P34529|DCR1_CAEEL.       RRSRTVSNS---STSNIPQASASDSKESNTSVPHSSQRQILVPELMDIHPISATLWNVIA

A1ZAW0|DCR2_DROME.       LTFYVHNRGKFNAKSKAKMK------------------VILIPELCFNFNFPGDLWLKLI

                               .      . .                       **:***   . :.. **   

 

Q9UPY3|DICER_HUMAN.      CLPSILYRLHCLLTAEELRAQTASDAGVGVRSLP-ADFRYPNLDFGW-------KKSIDS

Q8R418|DICER_MOUSE.      CLPSILYRLHCLLTAEELRAQTASDAGVGVRSLP-VDFRYPNLDFGW-------KKSIDS

Q9VCU9|DCR1_DROME.       CLPCILYRINGLLLADDIRKQVSADLGLGRQQIEDEDFEWPMLDFGWSLSE-VLKKSRES

P34529|DCR1_CAEEL.       ALPSIFYRVNQLLLTDELRETILVKAFGKEKTKLDDNVEWNSLAYATEYEEKQTIIVKKI

A1ZAW0|DCR2_DROME.       FLPSILNRMYFLLHAEALRKRFNTYLNLHLLPFNGTDYMPRPLEIDYS-----------L

                          **.*: *:  ** :: :*                 :     *                

 

Q9UPY3|DICER_HUMAN.      KSFISISNSSSAENDNYCKHS-TIVPENAAHQGANRTSSLENHDQMSVNCRTLLSESPGK

Q8R418|DICER_MOUSE.      KSFISTCNSSLAESDNYCKHSTTVVPEHAAHQGATRP-SLENHDQMSVNCKRLPAESPAK

Q9VCU9|DCR1_DROME.       KQKESLKDDTINGKDLADVEKKPTSEETQLDKDSKDDKVEKSAIELIIEGEEKLQEADDF

P34529|DCR1_CAEEL.       QQLRDLNQKSIEDQERETRENDKIDDGEELFNIGVWDPEEAVRIGVEISSRDDRMDGEDQ

A1ZAW0|DCR2_DROME.       KRNVDPLGNVIPTED--------IEEPKSLLEPMPTKSIEASVANLEITEFEN-PWQKYM

                         :   .   .    .:                :             : :           

 

Q9UPY3|DICER_HUMAN.      LHVEVSADLTAINGLSYNQN---------------------------------LANGSYD

Q8R418|DICER_MOUSE.      LQSEVSTDLTAINGLSYNKN---------------------------------LANGSYD

Q9VCU9|DCR1_DROME.       IEIGTWSNDMADDIASFNQEDDDEDDAFHLPVLPANVKFCDQQTRYGSPTFWDVSNGESG

P34529|DCR1_CAEEL.       DTVGLTQGLHDGNISDEDDE---------------------------------LPFVMHD

A1ZAW0|DCR2_DROME.       EPVDLSRNLLSTYPVELDYY--------------------------------------YH

                                .       . :                                         

 

Q9UPY3|DICER_HUMAN.      LANRDFCQGNQLNYYKQEIPVQPTTSYSIQN---LYSYENQPQPSDECTLLSNKYLDGNA

Q8R418|DICER_MOUSE.      LVNRDFCQGNQLNYFKQEIPVQPTTSYPIQN---LYNYENQPKPSNECPLLSNTYLDGNA

Q9VCU9|DCR1_DROME.       FKGPKSSQNKQGGKGKAKGPAKPTFNYYDSDNSLGSSYDDDDNAGPLNYMHHNYSSDDDD

P34529|DCR1_CAEEL.       YTARLTSNRNGIGAWSGSESIVPSGWGDWDG--------PEPDNSPMPFQILGGPGGLNV

A1ZAW0|DCR2_DROME.       FSVGNVCEMNEMDFEDKEYWAKNQFHMPTGN-------------------IYGNRTPAKT

                               .: :  .  . .            .                     .     .

 

Q9UPY3|DICER_HUMAN.      NKSTSDGSPVMAVMPGTTDTIQVLKGRMDSEQSPSIGYSS----RTLGPNPG---LIL--

Q8R418|DICER_MOUSE.      NTSTSDGSPAVSTMPAMMNAVKALKDRMDSEQSPSVGYSS----RTLGPNPG---LIL--

Q9VCU9|DCR1_DROME.       VADDIDAGRIAFTSKNEAETIETAQEVEKRQKQLSIIQATNANERQYQQTKN---LLIGF

P34529|DCR1_CAEEL.       QALMADVGRVFDPSTASSSLSQTVQESTVSPPKQLTKEEE-----QFKKLQNDLL-----

A1ZAW0|DCR2_DROME.       NANVPALMPSKPTVRGKVKPLLILQKTVSKEHITPAEQGE-----FLAAITAS-------

                                           .     :                                  

 

Q9UPY3|DICER_HUMAN.      --------QALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCT-YPDAHEGRLSYMRSK

Q8R418|DICER_MOUSE.      --------QALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCT-YPDAHEGRLSYMRSK

Q9VCU9|DCR1_DROME.       NFKHEDQKEPATIRYEESIAKLKTEIESGGMLVPHDQQLVLKRSDAAEAQVAKVSMMELL

P34529|DCR1_CAEEL.       ---------------KQAKERLEALEMSEDMEKPRRLEDTVNLEDYGDDQENQEDENTPT

A1ZAW0|DCR2_DROME.       --------------SAADVFDMERLEILGDSFLKLSATLYLASK-YSDWNEGTLTEVKSK

                                              ::      .          :      : :         

 

Q9UPY3|DICER_HUMAN.      K--VSNCNLYRLGKKKGLPSRMVVS-IFDPPVNWLP--------------------PGYV

Q8R418|DICER_MOUSE.      K--VSNCNLYRLGKKKGLPSRMVVS-IFDPPVNWLP--------------------PGYV

Q9VCU9|DCR1_DROME.       KQLLPYVNEDVLAKKLGDRRELLLSDLVELNADWVARHEQETYNVMGCGDSFDNYNDHHR

P34529|DCR1_CAEEL.       N-FPKTIDEEIEELSIGARKKQEIDDNAAKTDVLER------------------------

A1ZAW0|DCR2_DROME.       LVSNRNLLFCLIDADIP---KTLNTIQFTPRYTWLP------------------------

                                       .     .                                      

 

Q9UPY3|DICER_HUMAN.      VNQD----KSNTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEESLMWRAPKEEADYEDDF

Q8R418|DICER_MOUSE.      VNQD----KSNSEKWEKDEMTKDCLLANGKLGEACEEE----EDLTWRAPKEEAEDEDDF

Q9VCU9|DCR1_DROME.       LNLDEKQLKLQYERIEIEPPTSTKAITSAILPAGFSFD-RQPDLVGHPGPSPSIILQALT

P34529|DCR1_CAEEL.       ENCEVLPVAINEKSRSFSFEKESKAINGRLIRQRSEEYVSHIDSDIGLGVSPCLLLTALT

A1ZAW0|DCR2_DROME.       -------PGISLPHNVLALWRENPEFAKIIGPHNLRDLALGDEESLVKGNCSDINYNRFV

                                   .          .   :                :     .          

 

Q9UPY3|DICER_HUMAN.      LEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSS--------------

Q8R418|DICER_MOUSE.      LEYDQEHIQFIDSMLMGSGAFVRKISLSPFSASDSAYEWKMPKKAS--------------

Q9VCU9|DCR1_DROME.       MSNANDGINLERLETIGDSFLKYAITTYLYITYENVHEGKLSHLRSKQVANLNLYRLGRR

P34529|DCR1_CAEEL.       TSNAADGMSLERFETIGDSFLKFATTDYLYHTLLDQHEGKLSFARSKEVSNCNLYRLGKK

A1ZAW0|DCR2_DROME.       EGCRANGQSFYAGADFSSEVNFCVG-----------------------------------

                              :   :     :..                                         

 

Q9UPY3|DICER_HUMAN.      --LGSMPFSSDFEDFDYSSWDAMCYLDP---SKAVEEDDFVVGFWNPS------------

Q8R418|DICER_MOUSE.      --LGSMPFASGLEDFDYSSWDAMCYLDP---SKAVEEDDFVVGFWNPS------------

Q9VCU9|DCR1_DROME.       KRLGEYMIATKFEPHDN--WLPPCYYVPKELEKALIEAKIPTHHWKLADLLDIKNLSSVQ

P34529|DCR1_CAEEL.       LGIPQLIVANKFDAHDS--WLPPCYIPT-CDFKAPNTDDAEEKDNEIERILDGQVIEEKP

A1ZAW0|DCR2_DROME.       ------------------------------------------------------------

                                                                                    

 

Q9UPY3|DICER_HUMAN.      --------------EENCGVDTGKQS------------ISYDLHTEQCIADKSIADCVEA

Q8R418|DICER_MOUSE.      --------------EENCGVDTGKQS------------ISYDLHTEQCIADKSIADCVEA

Q9VCU9|DCR1_DROME.       ICEMVREKADALGLEQNGGAQNGQLDDSNDSCNDFSCFIPYNLVSQHSIPDKSIADCVEA

P34529|DCR1_CAEEL.       ENKTGWDIGGDVSKSTTDGIETITFPKQARVGNDDISPLPYNLLTQQHISDKSIADAVEA

A1ZAW0|DCR2_DROME.       ---------------------------------------------LVTIPNKVIADTLEA

                                                                         *.:* *** :**

 

Q9UPY3|DICER_HUMAN.      LLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVSCAAAS

Q8R418|DICER_MOUSE.      LLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTSREKALDPAQENGSSQQKSLSGSCAAP-

Q9VCU9|DCR1_DROME.       LIGAYLIECGPRGALLFMAWLGVRVLPITRQLD-----------GGNQEQRIPGSTKPN-

P34529|DCR1_CAEEL.       LIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSD----------VPSPLLRFIDTPTNPN-

A1ZAW0|DCR2_DROME.       LLGVIVKNYGLQHAFKMLEYFKICRADIDKPLT-----------QLLNLELGGKKMR---

                         *:*  :   * . :  .:  : :      :                   .         

 

Q9UPY3|DICER_HUMAN.      VASSRSSVLKDSEYGCLKIP-PRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKAYLL

Q8R418|DICER_MOUSE.      -VGPRSSAGKDLEYGCLKIP-PRCMFDHPDAEKTLNHLISGFETFEKKINYRFKNKAYLL

Q9VCU9|DCR1_DROME.       ------AENVVTVYGAWPTPRSPLLHFAPNATEELDQLLSGFEEFEESLGYKFRDRSYLL

P34529|DCR1_CAEEL.       --------------------------ASLNFLNNLWQQFQ-FTQLEEKIGYRFKERAYLV

A1ZAW0|DCR2_DROME.       ---------------------------ANVNTTEIDGFLINHYYLEKNLGYTFKDRRYLL

                                                           :   :  .  :*:.:.* *::: **:

 

Q9UPY3|DICER_HUMAN.      QAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTI

Q8R418|DICER_MOUSE.      QAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTI

Q9VCU9|DCR1_DROME.       QAMTHASYTPNRLTDCYQRLEFLGDAVLDYLITRHLYEDPRQHSPGALTDLRSALVNNTI

P34529|DCR1_CAEEL.       QAFTHASYINNRVTGCYQRLEFLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTI

A1ZAW0|DCR2_DROME.       QALTHPSYPTNRITGSYQELEFIGDAILDFLISAYIFENNTKMNPGALTDLRSALVNNTT

                         **:**.**  * :*..**.***:***:**::*: :::*:  : .**.************

 

Q9UPY3|DICER_HUMAN.      FASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEK--NEMQGMDSELRRSEEDEEK----

Q8R418|DICER_MOUSE.      FASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEK--NEMQGMDSELRRSEEDEEK----

Q9VCU9|DCR1_DROME.       FASLAVRHGFHKFFRHLSPGLNDVIDRFVRIQQEN--GHCISEEYYLLS-EEECDD----

P34529|DCR1_CAEEL.       FASLAVKFEFQKHFIAMCPGLYHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEG---

A1ZAW0|DCR2_DROME.       LACICVRHRLHFFILAENAKLSEIISKFVNFQESQ--GHRVTNYVRILLEEADVQPTPLD

                         :*.:.*:.  : .:    . * .:*. **.:  ..  .        :   * : :    

 

Q9UPY3|DICER_HUMAN.      ---------------------------------EEDIEVPKAMGDIFESLAGAIYMDSGM

Q8R418|DICER_MOUSE.      ---------------------------------EEDIEVPKAMGDIFESLAGAIYMDSGM

Q9VCU9|DCR1_DROME.       ---------------------------------AEDVEVPKALGDVFESIAGAIFLDSNM

P34529|DCR1_CAEEL.       --------------------------------QEEDIEVPKAMGDIFESVAGAIYLDSGR

A1ZAW0|DCR2_DROME.       LDDELDMTELPHANKCISQEAEKGVPPKGEFNMSTNVDVPKALGDVLEALIAAVYLDCR-

                                                            :::****:**::*:: .*:::*. 

 

Q9UPY3|DICER_HUMAN.      SLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDG-KVRVTVEV

Q8R418|DICER_MOUSE.      SLEVVWQVYYPMMQPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDG-KVRVTVEV

Q9VCU9|DCR1_DROME.       SLDVVWHVYSNMMSPEIEQFSNSVPKSPIRELLELEPETAKFGKPEKLADGRRVRVTVDV

P34529|DCR1_CAEEL.       NLDTTWQVIFHMMRGTIELCCANPPRSPIRELMEFEQSKVRFSKMERILESGKVRVTVEV

A1ZAW0|DCR2_DROME.       DLQRTWEVIFNLFEPELQEFTRKVPINHIRQLVEHKHAKPVFSSPIVEGETVMVSCQFTC

                         .*: .*.*   ::   ::    . * . :*:*:* :  .  *.      :   *   . 

 

Q9UPY3|DICER_HUMAN.      VGK-GKFKGVGRSYRIAKSAAARRALRSLKANQPQVPNS------

Q8R418|DICER_MOUSE.      VGK-GKFKGVGRSYRIAKSAAARRALRSLKANQPQVPNS------

Q9VCU9|DCR1_DROME.       FCK-GTFRGIGRNYRIAKCTAAKCALRQLKKQGLIAKKD------

P34529|DCR1_CAEEL.       VNN-MRFTGMGRNYRIAKATAAKRALKYLHQIEQQRRQSPSLTTV

A1ZAW0|DCR2_DROME.       MEKTIKVYGFGSNKDQAKLSAAKHALQQLSKCDA-----------

                         . :   . *.* .   ** :**: **: *