S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Drh1 RIG-I
DHX58
RIG-I
DHX58
Database Links
Protein MDA5
IFIH1
MDA5
IFIH1
Database Links
Cellular Function Pattern Recognition Receptor of the Innate Immune System Pattern Recognition Receptor of the Innate Immune System

Group Alignment

Q9BYX4|MDA5_HUMAN.            ----------------------------------------MSNGYSTDEN

Q8R5F7|MDA5_MOUSE.            ----------------------------------------MSIVCSAEDS

O95786|RIG-I/DHX58_HUMAN      ----------------------------------------------MTTE

Q6Q899|RIG-I/DHX58_MOUSE      ----------------------------------------------MTAA

O44165|Drh1_CAEEL             --------------------------------------MRKKQCSSILSL

Q93413|Drh-3_CAEEL.           MQPTAIRLEDYDKSKLRLPFESPYFPAYFRLLKWKFLDVCVESTRNNDIG

                                                                               

 

Q9BYX4|MDA5_HUMAN.            FRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQR----TVATSGNM

Q8R5F7|MDA5_MOUSE.            FRNLILFFRPRLKMYIQVEPVLDHLIFLSAETKEQILK----KINTCGNT

O95786|RIG-I/DHX58_HUMAN      QRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQ----AEKNNKGP

Q6Q899|RIG-I/DHX58_MOUSE      QRQNLQAFRDYIKKILDPTYILSYMSSWLEDEEVQYIQ----AEKNNKGP

O44165|Drh1_CAEEL             YDKEIILCLEPIYRDPEKGDGFSELLPLGRIDELKIQS----ENAQEFSK

Q93413|Drh-3_CAEEL.           YFKLFESLFPPGKLEEIARMIIDEPTPVSHDPDMIKIRNADLDVKIRKQA

                                  :                :.         .                

 

Q9BYX4|MDA5_HUMAN.            QAVELLLSTLEKGVWHLGWTREFVEALR--RTGSPLAARYMNPELTDLPS

Q8R5F7|MDA5_MOUSE.            SAAELLLSTLEQGQWPLGWTQMFVEALE--HSGNPLAARYVKPTLTDLPS

O95786|RIG-I/DHX58_HUMAN      MEAATLFLKFLLELQEEGWFRGFLDALD--HAG--YSGLYEAIESWDFKK

Q6Q899|RIG-I/DHX58_MOUSE      MEAASLFLQYLLKLQSEGWFQAFLDALY--HAG--YCGLCEAIESWDFQK

O44165|Drh1_CAEEL             QLYHDLKNSILSNADDERLYKDIMTYLQT-YLPKCTVHKLLNCSNREVKL

Q93413|Drh-3_CAEEL.           ETYVTLRHAHQQKVQRRRFSECFLNTVLFDEKGLRIADEVMFNYDKELYG

                                   *              . ::  :                   :. 

 

Q9BYX4|MDA5_HUMAN.            PSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAA

Q8R5F7|MDA5_MOUSE.            PSSETAHDECLHLLTLLQPTLVDKLLINDVLDTCFEKGLLTVEDRNRISA

O95786|RIG-I/DHX58_HUMAN      ---IEKLEEYRLLLKRLQPEFKTRIIPTDIIS-DLSECLINQECEEILQI

Q6Q899|RIG-I/DHX58_MOUSE      ---IEKLEEHRLLLRRLEPEFKATVDPNDILS-ELSECLINQECEEIRQI

O44165|Drh1_CAEEL             SDFHYILDHFEGFLRFIEPKVVLAYLDS---YPQYIDAVAVLRKEIERNE

Q93413|Drh-3_CAEEL.           YSHWEDLPDGWLTAETFKNKFYDEEEVTNNPFGYQKLDRVAGAARGMIIM

                                      .       ::  .                       .    

 

Q9BYX4|MDA5_HUMAN.            AENNGNESGVRELLKRIVQ--KENWFSAFLNVLRQTGNNELVQELTGSDC

Q8R5F7|MDA5_MOUSE.            AGNSGNESGVRELLRRIVQ--KENWFSTFLDVLRQTGNDALFQELTGGGC

O95786|RIG-I/DHX58_HUMAN      CSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNK-----------

Q6Q899|RIG-I/DHX58_MOUSE      RDTKGRMAGAEKMAECLIRSDKENWPKVLQLALEKDNSK-----------

O44165|Drh1_CAEEL             EDNQDSDFIKKLILRTVPLLGEQAVYDIMYTISEKSSNN-----------

Q93413|Drh-3_CAEEL.           KHLKSNPRCVSETTILAFEVFNKGNHQLSTDLVEDLLTEGPAFELKIENG

                                 ..                ::   .      ..  ..          

 

Q9BYX4|MDA5_HUMAN.            SESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADS

Q8R5F7|MDA5_MOUSE.            PEDNTDLANSSHRDGPAANECLLPAVDESSLETEAWNVDDILPEASCTDS

O95786|RIG-I/DHX58_HUMAN      -------------------------------FSELWIVEKG-----IKDV

Q6Q899|RIG-I/DHX58_MOUSE      -------------------------------FSELWIVDKG-----FKRA

O44165|Drh1_CAEEL             ---------LDVEAKQFIAKVLRLKNDGFLRFYQIINASRRQLNGRIYIC

Q93413|Drh-3_CAEEL.           EEKKYAVKKWSLHKTLTMFLAIIGFKSNDKKEKNEHEEWYYGFIDAMKND

                                                               :               

 

Q9BYX4|MDA5_HUMAN.            SVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAAR-AS

Q8R5F7|MDA5_MOUSE.            SVTTESDTSLAEGSVSCFDESLGHNSNMGRDSGTMGSDSDESVIQTKRVS

O95786|RIG-I/DHX58_HUMAN      ET-EDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSDT--------N

Q6Q899|RIG-I/DHX58_MOUSE      ESKADEDDGAEASSIQIFIQEEPECQNLSQNPGPPSEASSN--------N

O44165|Drh1_CAEEL             PVHESATEMMVYLGTAALNTNRYRMINIRVDNIVQENSTPRLVIESVRQR

Q93413|Drh-3_CAEEL.           PANRAALYFLDKNWPEELEEREKERDRIRLTLLKSQRTNEEAVGEDVCTT

                                               :     .  .:          .          

 

Q9BYX4|MDA5_HUMAN.            PEPE--------------LQLRPYQMEVAQPALEGKNIIICLPTGSGKTR

Q8R5F7|MDA5_MOUSE.            PEPE--------------LQLRPYQMEVAQPALDGKNIIICLPTGSGKTR

O95786|RIG-I/DHX58_HUMAN      LYSP--------------FKPRNYQLELALPAMKGKNTIICAPTGCGKTF

Q6Q899|RIG-I/DHX58_MOUSE      LHSP--------------LKPRNYQLELALPAKKGKNTIICAPTGCGKTF

O44165|Drh1_CAEEL             IHRQR------------QLCLRNYQEELCQVALQGKNTIVTAPTGSGKTV

Q93413|Drh-3_CAEEL.           IRPQPKDSGYNPDAVVTELVLRTYQEELVQPALEGKNCVIVAPTGSGKTE

                                                :  * ** *:   * .*** ::  ***.***

 

Q9BYX4|MDA5_HUMAN.            VAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRV

Q8R5F7|MDA5_MOUSE.            VAVYITKDHLDKKKQASESGKVIVLVNKVMLAEQLFRKEFNPYLKKWYRI

O95786|RIG-I/DHX58_HUMAN      VSLLICEHHLKKFPQG-QKGKVVFFANQIPVYEQQKSVFSKYFERHGYRV

Q6Q899|RIG-I/DHX58_MOUSE      VSLLICEHRLKKFPCG-QKGKVVFFANQIPVYEQQATVFSRYFERLGYNI

O44165|Drh1_CAEEL             IAANIIKEHFESRSSEGKRFKALFMTPNSMILNQQAASISSYLDHVYHTQ

Q93413|Drh-3_CAEEL.           VAIYAALKHIEERTSQGKPSRVVLLVPKIPLVGQQKDRFLKYCNGMYEVN

                              ::     .::..     :  :.:.:. :  :  *               

 

Q9BYX4|MDA5_HUMAN.            IGLSGDTQLKIS-FPEVVKSCDIIISTAQILENSLLNLENGED-----AG

Q8R5F7|MDA5_MOUSE.            IGLSGDTQLKIS-FPEVVKSYDVIISTAQILENSLLNLESGDD-----DG

O95786|RIG-I/DHX58_HUMAN      TGISGATAENVP-VEQIVENNDIIILTPQILVN---NLKKG-------TI

Q6Q899|RIG-I/DHX58_MOUSE      ASISGATSDSVS-VQHIIEDNDIIILTPQILVN---NLNNG-------AI

O44165|Drh1_CAEEL             IIQG---SDNVP-TRNVIQSKDLIVATPQMIVNLCNEHRNSLDDESRLDQ

Q93413|Drh-3_CAEEL.           GFHGSESSVSGTGRRDEVIATHVSVMTPQILINMLQSVRQN-------ER

                                 .     . .   . :   .: : *.*:: *   . ...        

 

Q9BYX4|MDA5_HUMAN.            VQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPL

Q8R5F7|MDA5_MOUSE.            VQLSDFSLIIIDECHHTNKEAVYNNIMRRYLKQKLRNNDLKKQNKPAIPL

O95786|RIG-I/DHX58_HUMAN      PSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSG--------PL

Q6Q899|RIG-I/DHX58_MOUSE      PSLSVFTLMIFDECHNTSKNHPYNQIMFRYLDHKLGESRD--------PL

O44165|Drh1_CAEEL             FFLSTFTIIFFDECHNTVKNSPYSNIMREYHYLKNMGNMPEG-----HSL

Q93413|Drh-3_CAEEL.           LYVSDFSMMIFDEVHKAAKNHPYVLINQMVQEWKYE-------------K

                                :* *:::::** *:: *:  *  *       *               

 

Q9BYX4|MDA5_HUMAN.            PQILGLTASPGVGG--ATKQAKAEEHILKLCANLDAFTIKTVKEN--LDQ

Q8R5F7|MDA5_MOUSE.            PQILGLTASPGVGA--AKKQSEAEKHILNICANLDAFTIKTVKEN--LGQ

O95786|RIG-I/DHX58_HUMAN      PQVIGLTASVGVGD--AKNTDEALDYICKLCASLDASVIATVKHN--LEE

Q6Q899|RIG-I/DHX58_MOUSE      PQVVGLTASVGVGD--AKTAEEAMQHICKLCAALDASVIATVRDN--VAE

O44165|Drh1_CAEEL             PQIIGLTASLGTGD--KNDCLQVRNYIAGLCASMDVKDLSIVKDN--LEE

Q93413|Drh-3_CAEEL.           PQIIGLTASLSVKVDGQKDENQMLNDIYNMLALINAPHLSTITRQSSIDE

                              **::***** ..     .   :  . *  : * ::.  :  :  :  : :

 

Q9BYX4|MDA5_HUMAN.            LKNQIQEPCKKFAIADATRE----DPFKEKLLEIMTRIQTYCQ-------

Q8R5F7|MDA5_MOUSE.            LKHQIKEPCKKFVIADDTRE----NPFKEKLLEIMASIQTYCQ-------

O95786|RIG-I/DHX58_HUMAN      LEQVVYKPQKFFRKVESRIS----DKFKYIIAQLMRDTESLAKRICKDLE

Q6Q899|RIG-I/DHX58_MOUSE      LEQVVYKPQKISRKVASRTS----NTFKCIISQLMKETEKLAKDVSEELG

O44165|Drh1_CAEEL             LRGYSPIVPDKVLLCERSTDGPI-GMFTNRLTLMMQEVEGLIRTALRN-E

Q93413|Drh-3_CAEEL.           LNEHVGKPDDSVELCLPAKENILRDYIERYLNHAHGKFLEELASMSKSTG

                              *.       .         .    . :   :                   

 

Q9BYX4|MDA5_HUMAN.            ---MSPMSDFGTQPYEQWAIQMEKKAAKEGNRKER------------VCA

Q8R5F7|MDA5_MOUSE.            ---KSPMSDFGTQHYEQWAIQMEKKAAKDGNRKDR------------VCA

O95786|RIG-I/DHX58_HUMAN      NLSQIQNREFGTQKYEQWIVTVQKACMVFQMPDKDEESRICKAL--FLYT

Q6Q899|RIG-I/DHX58_MOUSE      KLFQIQNREFGTQKYEQWIVGVHKACSVFQMADKEEESRVCKAL--FLYT

O44165|Drh1_CAEEL             HIGIEQRRQIETTERDFRPDSSFLDPPADKEHAGYQNWVCNQMN--LVSG

Q93413|Drh-3_CAEEL.           RNNTIPPNMINTFKKNQPKNYEYYDSLLQGIIQELNKLNVPEKWNSQTWA

                                       : *   :                                 

 

Q9BYX4|MDA5_HUMAN.            EHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDD

Q8R5F7|MDA5_MOUSE.            EHLRKYNEALQINDTIRMIDAYSHLETFYTDEKEKKFAVLND-SDKSDDE

O95786|RIG-I/DHX58_HUMAN      SHLRKYNDALIISEHARMKDALDYLKDFFSNVR-----------------

Q6Q899|RIG-I/DHX58_MOUSE      SHLRKYNDALIISEDAQMTDALNYLKAFFHDVR-----------------

O44165|Drh1_CAEEL             TSFRETGTRTIINEALDVLKECFCTLSYNINFHP----------------

Q93413|Drh-3_CAEEL.           KYMKVYLEARGIVDLMPAMVAFKYMEKAIGKLN-----------------

                                ::       * :                . .                

 

Q9BYX4|MDA5_HUMAN.            EYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKL

Q8R5F7|MDA5_MOUSE.            ASSCNDQLKGDVKKSLKLDETDEFLMNLFFDNKKMLKKLAENPKYENEKL

O95786|RIG-I/DHX58_HUMAN      --------------AAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKL

Q6Q899|RIG-I/DHX58_MOUSE      --------------EAAFDETERELTRRFEEKLEELEKVSRGPSNENPKL

O44165|Drh1_CAEEL             ------EVALNYLKDEMEYRTPNFTVNMIRIWERYHNQLVGTGSAENPMI

Q93413|Drh-3_CAEEL.           -----------------ESHSETVEYSTFIKDHDTLKQTIQS--VEPEIV

                                                 .        :       :        *   :

 

Q9BYX4|MDA5_HUMAN.            TKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKA

Q8R5F7|MDA5_MOUSE.            IKLRNTILEQFTRSEESSRGIIFTKTRQSTYALSQWIMENAKFAEVGVKA

O95786|RIG-I/DHX58_HUMAN      EDLCFILQEEYHLNPETIT-ILFVKTRALVDALKNWIEGNPKLSFL--KP

Q6Q899|RIG-I/DHX58_MOUSE      RDLYLVLQEEYHLKPETKT-ILFVKTRALVDALKKWIEENPALSFL--KP

O44165|Drh1_CAEEL             SKTVQYIVEQNLQRADSRT-IIFVRTRYEATILNKVLNSNEELLMLGIKS

Q93413|Drh-3_CAEEL.           LRLKNTLTNQFHVAPESRV-IIFVTQRSTAQRVSDFLNESKVLDQFGNYG

                                    : ::     ::   *:*.  *  .  :.. :  .  :  .   

 

Q9BYX4|MDA5_HUMAN.            HHLIGAGHSSEFKPMTQNEQKEVISKFRT---GKINLLIATTVAEEGLDI

Q8R5F7|MDA5_MOUSE.            HHLIGAGHSSEVKPMTQTEQKEVISKFRT---GEINLLIATTVAEEGLDI

O95786|RIG-I/DHX58_HUMAN      GILTGRGKTNQNTGMTLPAQKCILDAFKAS--GDHNILIATSVADEGIDI

Q6Q899|RIG-I/DHX58_MOUSE      GILTGRGRTNRATGMTLPAQKCVLEAFRAS--GDNNILIATSVADEGIDI

O44165|Drh1_CAEEL             EWMSGLNKSTASSADISASKQKQMEKLKMFADGEIRILVSTSVAEEGLDV

Q93413|Drh-3_CAEEL.           EQMVGYVLGTNKQGAVQQTSQEQQLTLDKFNNGRLKVIVATSVVEEGLDV

                                : *    .         .:     :     *  .::::*:*.:**:*:

 

Q9BYX4|MDA5_HUMAN.            KECNIVIRYGLVTN-EIAMVQARGRARADESTYVLVAHSGSGVIEHETVN

Q8R5F7|MDA5_MOUSE.            KECNIVIRYGLVTN-EIAMVQARGRARADESTYVLVTSSGSGVTEREIVN

O95786|RIG-I/DHX58_HUMAN      AQCNLVILYEYVGN-VIKMIQTRGRGRARGSKCFLLTSN-AGVIEKEQIN

Q6Q899|RIG-I/DHX58_MOUSE      AECNLVILYEYVGN-VIKMIQTRGRGRARDSKCFLLTSS-ADVIEKEKAN

O44165|Drh1_CAEEL             PECSLVIKYNYATN-EIAHVQRRGRGRALNSECVLITNS-IALRDQESNN

Q93413|Drh-3_CAEEL.           TACNLIIKYNCSSGSAIQLVQQRGRARAKNSRSVLLSVK-SSINETETNA

                                *.::* *    .  *  :* ***.**  *  .*:: .   : : *  

 

Q9BYX4|MDA5_HUMAN.            DFREKMMYKAIHCVQNMKPEEYAHKILE--LQMQSIMEKKMKTKRNIAKH

Q8R5F7|MDA5_MOUSE.            DFREKMMYKAINRVQNMKPEEYAHKILE--LQVQSILEKKMKVKRSIAKQ

O95786|RIG-I/DHX58_HUMAN      MYKEKMMNDSILRLQTWDEAVFREKILH--IQTHEKFIRDSQEKPKPVPD

Q6Q899|RIG-I/DHX58_MOUSE      MIKEKIMNESILRLQTWDEMKFGKTVHR--IQVNEKLLRDSQHKPQPVPD

O44165|Drh1_CAEEL             RDKESLMSETISLIQNS-PAEFRKCVDEESNKIWPRILREDTDKAQKIEE

Q93413|Drh-3_CAEEL.           LISEKYMRLCVKKITENGEKQLAAEVKR--VAELNAAERKRNLEEQLNLR

                                 *. *   :  :           : .          :.   : .   

 

Q9BYX4|MDA5_HUMAN.            YKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENK

Q8R5F7|MDA5_MOUSE.            YNDNPSLITLLCKNCSMLVCSGENIHVIEKMHHVNMTPEFKGLYIVRENK

O95786|RIG-I/DHX58_HUMAN      KENK----KLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRP-H

Q6Q899|RIG-I/DHX58_MOUSE      KENK----KLLCGKCKNFACYTADIRVVETSHYTVLGDAFKERFVCKP-H

O44165|Drh1_CAEEL             QINRNIVYKIICKKCEAILCTSKDIRSRN-TQYLVCDPGFWSLVRKTRLT

Q93413|Drh-3_CAEEL.           LRHENKIYKLMCSNCSKEFCKSIYIKKVFSNYMVFDPSVWRFLHVESKRK

                                ..    .::* :*.   *    ::             :         

 

Q9BYX4|MDA5_HUMAN.            ALQKKCADYQINGEIICK---CGQAWGTMMVHKGLDLPCLKIRNFVVVFK

Q8R5F7|MDA5_MOUSE.            ALQKKFADYQTNGEIICK---CGQAWGTMMVHKGLDLPCLKIRNFVVNFK

O95786|RIG-I/DHX58_HUMAN      PKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDI

Q6Q899|RIG-I/DHX58_MOUSE      PKPKIYDNFEKKAKIFCAKQNCSHDWGIFVRYKTFEIPVIKIESFVVEDI

O44165|Drh1_CAEEL             DEQQALIKYNATGSINCRRENCGLKLGQLIEVNTVDLPCLSALSIVLLVE

Q93413|Drh-3_CAEEL.           VSKYLSEDNQPLSDIKCFH--CKLDVGRAYKIRGTYLPQLSVKALTFVQE

                                     . :  ..* *    *    *     .   :* :.   :..  

 

Q9BYX4|MDA5_HUMAN.            NNSTKKQYKKWV---ELPITFPNLDYSECCLFSDED--------------

Q8R5F7|MDA5_MOUSE.            NNSPKKQYKKWV---ELPIRFPDLDYSEYCLYSDED--------------

O95786|RIG-I/DHX58_HUMAN      ATGVQTLYSKWK---DFHFEKIPFDPAEMSK-------------------

Q6Q899|RIG-I/DHX58_MOUSE      VSGVQNRHSKWK---DFHFERIQFDPAEMSV-------------------

O44165|Drh1_CAEEL             GTDKRIIVKKWKNILDKYFTPTEIRQLDVQTMRDADQARTPMVFEHHANG

Q93413|Drh-3_CAEEL.           SDYSSMTKAKWSDVEQDLFYISEAIEDDFRIMLNALSDTEENIEKKIVLD

                                       **    :  :        :                     

 

Q9BYX4|MDA5_HUMAN.            -------------------------------

Q8R5F7|MDA5_MOUSE.            -------------------------------

O95786|RIG-I/DHX58_HUMAN      -------------------------------

Q6Q899|RIG-I/DHX58_MOUSE      -------------------------------

O44165|Drh1_CAEEL             EVVNLIREA----------------------

Q93413|Drh-3_CAEEL.           LDSRQHNKQLEMKRFHIQQEPPTKGVAPEAQ