S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Ecm32
YER176W
CG6701
CG6967
Mov10 MOV10
Database Links  
Cellular Function miRNA function
Protein Dmel\armi
CG11513
Mov10l1 MOV10L1
Database Links    
Cellular Function miRNA function
Protein PRC285 PRC285
Database Links      
Cellular Function
Protein Dmel
CG9425
HELZ HELZ
Database Links    
Cellular Function
Protein ptMDFL ptMDFL
C4orf21
Database Links      
Cellular Function

Group Alignment

ptMRDFL_H.s.  --------------------------------------------------MESQEFIVLY

ptMRDFL_M.m.  --------------------------------------------------MECQEFIVLY

PRC285_H.s.   ------------------------------------------------------------

PR285_M.m.    --------------------------------------------------------MASV

MOV10L1_H.s.  MLSLAAKLVAFFWRTADTPREEAGQLEPELAEGDTKLKTVRGVVTRYCSDYGMIDDMIYF

Mov10L1_M.m.  ----------------------------------------------------MIDDLIYF

Armi_D.m.     --------------------------------------------------MSSEASGSIT

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     ------------------------------------------------------------

Helz_M.m.     ------------------------------------------------------------

CG9425_D.m.   -----------------------------------------------------MAAEKEM

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  THQKMKKSKVWQDGILKITHLGNKAILYDDKG--ACLESLFLKCLEVKPGDDLESDRYL-

ptMRDFL_M.m.  THQKMKKSKVWQDGVLKITHLGNKAILYDDKG--ACLESLFLKCLEVKPGDDLESERYL-

PRC285_H.s.   -------MAVWEAEQL----------------------GGLQRGDLLTPPAPDGDGRTA-

PR285_M.m.    GCSLRSASTSATNGPSLAGLCAKVDLYLGCSRCTQCLNESTYILREVEHTCPREILLARF

MOV10L1_H.s.  SSDAVTSRVLLNVGQEVIAVVEENKVSNGLKA--IRVEAVSDKWEDDSRNHGSPSDCGP-

Mov10L1_M.m.  SNDAVTSKVLLNVGQEVIAVVEENKVSNGLKA--IRVEAVSDKWEDDSKNSSKGLSDSSP

Armi_D.m.     IKEEASTSGTATNIPVESSETEAKKPEIGADK--AESQSETTEGGKAAETTENHLKRLQ-

MOV10_H.s.    MPSKFSCRQLREAGQCFESFLVVRGLDMETDR--ERLRTIYNRDFKISFGTPAPGFSSM-

Mov10_M.m.    MPSKFSCRKLRETGQRFESFLAERGLDLETDR--ERLRTIYNHDFKPSYGTPAPGFSSM-

CG6701_D.m.   ------MRKLFEVHLNALPNSSEIRQKLSSQG--ATNIGSLLHRTNFLINTPRGNPNYRI

CG6967_D.m.   ------MRELPYYPPSNEMIEANTNQDLSANN---SVFGDFMKTKRLEFYNVCSVMQTLL

HELZ_H.s.     MEDRRAEKSCEQACESLKRQDYEMALKHCTEA--LLSLGQYSMA-DFTGPCPLEIERIK-

Helz_M.m.     MEDRRAERSCEQACASLQRQDYDMALQHCTDA--LLSLGQYSMA-DFTGPCPVEVERIK-

CG9425_D.m.   QAHDMVRRRSWARAVALYDQLIAPSPGQGSGG--QSAGSRAQKDQQIA--CLLGRCECL-

YER176W_S.c.  --MDFQCRTCSQAYDA-------EQMMKHLSS--TRHKTVFDTSNDEDICCEECQDKNI-

 

 

ptMRDFL_H.s.  ITVEEVKVAGAIGIVKQNVNKEAPELNS-RTFISSGRSLGCQPSGLKRKFTGFQGPRQVP

ptMRDFL_M.m.  ITVEEAKAVGSRA-VEPDGSREALESGS-RTLVSSSRSLGCQPSGLKRKATGFQRPYKMP

PRC285_H.s.   ------------------------------------------------------------

PR285_M.m.    KQAAESKIWRKVGRRPSFPTPMRY-----QVCHYYRPGLGCRRHWNRCTFARSPEEALV-

MOV10L1_H.s.  -----RVLIGCVTSLVEGAGCISQT----TYFSLESVCEGFEPCKGD-------------

Mov10L1_M.m.  RVL-----IGCVTSMLEGAGYISQT----TYFSLESVCEGFHPCKGD-------------

Armi_D.m.     NLRKELSYLSETDWMYESLDKKAAH----KFFTNPDRNREDILESLDRENSFLDQK----

MOV10_H.s.    -------LYGMKIANLAYVTKTRV-----RFFRLDR------------------------

Mov10_M.m.    -------LYGMKIANLAFVTKTRV-----RFFKLDR------------------------

CG6701_D.m.   KNFSLMDFRKEKFNLLDEQHRL-------RGIASTTDVPGGAPAEGNK------------

CG6967_D.m.   T---IDDLSNMELYAQLIQSDVP------VQRVSKLTYKI--------------------

HELZ_H.s.     ----IESLLYRIASFLQLKNYV-------QADEDCRHVLGEGLAKGEDAFR---------

Helz_M.m.     ----IESLLYRIASFLQLKNYG-------QADEDCRHVLGEGLAKGERAFR---------

CG9425_D.m.   --LELGKFEGCLADAYKVLTLLSEQTECLASVSRARRWLVHALFKMHKYGDAE-------

YER176W_S.c.  HQLQIIRFGGEDMVLLCNSCFRK------EYSETERPSTSYSLQNG--------------

 

 

ptMRDFL_H.s.  KKMVIMESGESAASHEAKKTGPT---IFSPFCSMPPLFPTVGKKDVNNILADPENIVTYK

ptMRDFL_M.m.  KKVTITENSEPAASLGDENPGPPGPRLLPTFSSTLPLFPTVGQKDLTPVSTDNQSPITFS

PRC285_H.s.   ------------------------------------------------------------

PR285_M.m.    -----------------------------WTFELKNNLPRLKLK----------------

MOV10L1_H.s.  -----------------------------WVEAEYRIRPGTWSS----------------

Mov10L1_M.m.  -----------------------------WVEAEYWIRPGTWSS----------------

Armi_D.m.     -----------------------------LMEEKMDQQLKANPNEINGVLSNKIAELTHG

MOV10_H.s.    -----------------------------WADVRFPEKRRMKLG----------------

Mov10_M.m.    -----------------------------WADVQLPEKRRIKPG----------------

CG6701_D.m.   -----------------------------PIIEEYKLDTDVKP-----------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     -----------------------------AVLCCMQLKGKLQPV----------------

Helz_M.m.     -----------------------------AVLCCMQLKGKLQLV----------------

CG9425_D.m.   -----------------------------IFLSKWINELSGQQI----------------

YER176W_S.c.  -----------------------------SILKFWEKYVKVREC----------------

 

 

ptMRDFL_H.s.  NRERNAMDFSSVFSPSFQINPEVLCEENYFCSPVNSGNKLSDSLLTNEPVKRDSLASHYS

ptMRDFL_M.m.  NRERSDTPL-SLPSSYFKINTNTLGKEDKLCFPVSSETKHSDSLLASEPMRRNGLDSHCP

PRC285_H.s.   ------------------------------------------------------------

PR285_M.m.    EAVQGTRAPDRLQTPADTIRAEFGGHFQLLCAICFTCCPPCLCPV-DPRGHCPKHQICPT

MOV10L1_H.s.  --EATSVKPLRYKRVDKVCISSLCGRNGVLEESIFFTLDSLKLPDGYTPRRGDVVNAVVV

Mov10L1_M.m.  --EAISVKPLRYKRVDKVCISSLCGRNGVIEDSIFFSLDSLKLPEGYIPRRHDIVNAVVV

Armi_D.m.     LSEMDVSKESSCTARKGVI-TSLDGDRGVIDKDVLFETKVAEDIILDLHVGCVVEYLTFT

MOV10_H.s.    --------------------SDISKHHKSLLAKIFYD-----------------------

Mov10_M.m.    --------------------SNISKQHRSLLARIFHD-----------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ----------------------------------------------TFKSTPVNAEDFVA

HELZ_H.s.     ---------------STILAKSLTGE----------------------------------

Helz_M.m.     ---------------SSILAKSLSGE----------------------------------

CG9425_D.m.   ----YSDISKTLERYKSIIQMIMNGQHKAQALKIPHARLEDEMAILDTKLDHWATNNLPL

YER176W_S.c.  ----------CCDECGEESNLNANRNGEVLCDKCLPKSNRAKDFVSEKSGRFLYIY----

 

 

ptMRDFL_H.s.  GVSQNIRSKAQILALLKSESSSSCEELNSEMTEHFPQKQPQGSLKIATKPKYLIQQEECA

ptMRDFL_M.m.  GVSQNVRSKAQILALLKS-SSTNRKDLHGEIPGHFPKIEPQGCLNIISKP-----EEDYA

PRC285_H.s.   -----------------------------------PLGQPPGA-----------------

PR285_M.m.    LLIHVIVEGLKRQFVEVRPLPQRRHPLNYCMYVGRGVPCRHGASRC--------------

MOV10L1_H.s.  ESSQSC---------YVWRALCMTLVKRRDAAPVHEATHFYGT-----------------

Mov10L1_M.m.  ESSQSC---------YIWRALCMTPVKR-DATLGEAPQEPYGA-----------------

Armi_D.m.     TGEAMRVVKVKSILEHSWEDTSQKEIEKAVDNLKNEKPTFFNT-----------------

MOV10_H.s.    ----------------------RAEYLHGKHGVDVEVQGPHEA-----------------

Mov10_M.m.    ----------------------RAEYLHGKHGVDVEVQGPHEA-----------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   PNLDQVVLVP--------------------------------------------------

HELZ_H.s.     ------------------------------------------------------------

Helz_M.m.     ------------------------------------------------------------

CG9425_D.m.   DKYSKLLSNKGLKKREQQQQQQQQQQQQNGNGIGSYASSSSSS-----------------

YER176W_S.c.  ------------LGLNETQNSTRKPRKKGGRRVGRGKKGRKGA-----------------

 

 

ptMRDFL_H.s.  EMKSTENLYYQHQSENTMRNKSRWAMYLSSQSSPIHSSTVDGNDTERKPKAQEDDVNSNL

ptMRDFL_M.m.  ETQSIGNLRCEQQSENPTRTTSRWARYLPSQRSP-PCSAADENDTEDKPEAQEDVNIFNL

PRC285_H.s.   ------------------------------------------------------------

PR285_M.m.    --------------------------------------------EYAHSAVEMAVWKAEQ

MOV10L1_H.s.  --------------------------------------------ILLKNKGDIEVTQVTH

Mov10L1_M.m.  --------------------------------------------LLLKNKGDIEVTRMTS

Armi_D.m.     --------------------------------------------ETRSVLGLISQRLASS

MOV10_H.s.    --------------------------------------------RDGQLLIRLDLNRKEV

Mov10_M.m.    --------------------------------------------RDGQLLIHLDLNRKEV

CG6701_D.m.   --------------------------------------------TLLKFQKRLLLQSDKD

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     --------------------------------------------SLNGMVTKDLTRLKTL

Helz_M.m.     --------------------------------------------SLNGMVTKDLTRLKTL

CG9425_D.m.   ---------------------------------------STGSSSTMSSSSTSLHKTNDL

YER176W_S.c.  --------------------------------------------KIKKEKKETFEAKISR

 

 

ptMRDFL_H.s.  KDLSLQKIIQFVETYAEERKKYNVDQSVGNNDPSWNQEVKLEIPSFNESSSLQVTCSSAE

ptMRDFL_M.m.  SEL-LQKKSELFETCSKKGELHSEDKPVDNTCQYWNQEDNLA-PSFCKNSSVLVSCSSKE

PRC285_H.s.   ----------------------------------------------------QLYCPACL

PR285_M.m.    LD--------------------GLQRGDLLTYPLFGENKWKASPNPNPP-VTKLYCHACL

MOV10L1_H.s.  FG--------------------TLKEGRSKTMVIWIENKGDIP-------QNLVSCKLA-

Mov10L1_M.m.  FG--------------------TLKEGESKSIVIWIENKGKVS-------RELVSCRLA-

Armi_D.m.     ID---------------------VETEYGQLTVELDNIEMNFIPTNGD--RVRLECNIQL

MOV10_H.s.    LT---------------------------------------------------LRLRNGG

Mov10_M.m.    LT---------------------------------------------------LRLRNGG

CG6701_D.m.   FE------------------------------------------------LQSLGCYICQ

CG6967_D.m.   ------------------KASLLASPLPKQLVLALLP----------------------H

HELZ_H.s.     LS------------------------------------------------ETETATSNAL

Helz_M.m.     LT------------------------------------------------ETETATSNVL

CG9425_D.m.   LA--------------------AMKLTAGKHQPGSGDGSGSDQGDQA---APSTTCSYCT

YER176W_S.c.  IA-------------------YEVKKENSTIQSSSSSNLRNFKGFKAVESDPVVAAKVSK

 

 

ptMRDFL_H.s.  NDGILSESDIQEDNKIPFNQNDKGCIKGSVLIKENAQEVNTCGTLEKEYEQSESSLPELK

ptMRDFL_M.m.  NASLLSESDIQYSSKVPVNQHEK------VWTREGSQGADADAALEPEY-RPVSPLPEIG

PRC285_H.s.   VTCHSQEAFENHCASSEHAQMVAFDQALPWEHRSPPPGLS---KFELC---PKPDLCEYG

PR285_M.m.    VTCNSQEAFENHCSSLEHAQMVAFDQAVPWKHRAPPMGLS---KFDLC---PRPDLCEHG

MOV10L1_H.s.  -----------------------------GWDKSKQFRFQMLDKDQMCPVVSFVSVPEKE

Mov10L1_M.m.  -----------------------------NWDKAHQFRFETQGRSKSCPGAAAGSVPEGE

Armi_D.m.     DDGFVDKQGEILEVTKLFPTRIQ-----EGEKCIVERVYVHMVVLGPETYILKTDLPTGT

MOV10_H.s.    TQSVTLTHLFPLC-------------------RTPQFAFYNEDQELPCPLGPGECYELH-

Mov10_M.m.    SKPVTLTHLFPLC----------------W---TPQFVFYHGEQDLPCPLGPGESYELH-

CG6701_D.m.   ENFEKIEKYEEHV---------------EYHGDESDFQ-----SLKKMKKYPTPIVSLSY

CG6967_D.m.   PHEDLEPGDP--------------------------------------------------

HELZ_H.s.     SGYHVEDLDEGSCN--------------GWHFRPPPRGITSSEEYTLCKRFLEQGICRYG

Helz_M.m.     SGCHVEDLDEGSCN--------------GWHFRPPPRGITSSEEYTLCKRFLEQGICRYG

CG9425_D.m.   ITFQTRNELRQHCQTEAHQKVIMSDEGRDWKWRPPPRGYT-LDTYSLCETFSEAHICHYG

YER176W_S.c.  SETSRSNPGPSNRNKGKGNKANHKKNSGNGIGKEKERKTNIRNNVRNSQPIPEDRKNTNS

 

 

ptMRDFL_H.s.  HLQIES----SNNSRISDDITDMISESKMDNESLNSIHESLSNVTQPFLEVTFNLNNFET

ptMRDFL_M.m.  HKQTEVEASLSTSSRISDDIADMGSKSNADREDLKTVHKAV----QPFLEVSFNLSNFET

PRC285_H.s.   DACTKA------------------------------------------------------

PR285_M.m.    EVCIKA------------------------------------------------------

MOV10L1_H.s.  NSSDEN------------------------------------------------------

Mov10L1_M.m.  NVNSLN------------------------------------------------------

Armi_D.m.     DLHLGD------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   QTCVDS------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     AQCTSA------------------------------------------------------

Helz_M.m.     AQCTSA------------------------------------------------------

CG9425_D.m.   AQCVEA------------------------------------------------------

YER176W_S.c.  HVTTNS------------------------------------------------------

 

 

ptMRDFL_H.s.  SDTEEESQESNKISQDSESWVKDILVNDGNSCFQKRSENTNCEEIEGEHLPFLTSVSDKP

ptMRDFL_M.m.  SDTDEASQEDSRLSQDSERWEKEAVLTD-DSCVQKSCEDIGCREIVGK-LPLLSSTDDEP

PRC285_H.s.   -----------HSAQELQEWVR--------------------------------------

PR285_M.m.    -----------HSKQELQEWVQ--------------------------------------

MOV10L1_H.s.  -------------INSLNS-----------------------------------------

Mov10L1_M.m.  -----------HHREDKTDEIP--------------------------------------

Armi_D.m.     -----------IVLADLIECQY--------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     -----------HSQEELAEWQK--------------------------------------

Helz_M.m.     -----------HSQEELAEWQK--------------------------------------

CG9425_D.m.   -----------HGQDELNEWKE--------------------------------------

YER176W_S.c.  ---------GGKGKNESVDKHQ--------------------------------------

 

 

ptMRDFL_H.s.  TVTFPVKETLPSQFCDKTYVGFDMGICKTENTGKEIEE--YSDTLSNFES-FKWTDAVYG

ptMRDFL_M.m.  KEALPADGTLLSEFCDRTCVGFNSGPHGDVKTGKALEGQCHSDTGSSLDSSLEWSEDVAG

PRC285_H.s.   ------------RTQAVELRG---------------------------------------

PR285_M.m.    ------------RAQDMELRE---------------------------------------

MOV10L1_H.s.  ------------HTKNKTSQM---------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     -----------SKFTRRAIKI---------------------------------------

MOV10_H.s.    ------------VHCKTSFVG---------------------------------------

Mov10_M.m.    ------------IYCKTSIVG---------------------------------------

CG6701_D.m.   ------------HYFGFTLKT---------------------------------------

CG6967_D.m.   --------------MLRHVASVDKVSSTTVHVRFSRKHKAVLSGQRFYAIIRSRRLTIRY

HELZ_H.s.     ------------RYASRLIKL---------------------------------------

Helz_M.m.     ------------RYASRLIKL---------------------------------------

CG9425_D.m.   ------------RFEYRRMRM---------------------------------------

YER176W_S.c.  ------------LPQPKALNG---------------------------------------

 

 

ptMRDFL_H.s.  DNKEDANKPIQEVRINYDFALPPNKSKGINMNLHIPHIQNQIAENSNLFSEDAQPQPFIL

ptMRDFL_M.m.  DSREDASQSIQGNAINCGGVSPSKKPRGVNRSLYSPYLLTAVTD----------------

PRC285_H.s.   ------------------------------------------------------------

PR285_M.m.    ------------------------------------------------------------

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   M----------------YRALNLL------------------------QESPLVRRYLFP

HELZ_H.s.     ------------------------------------------------------------

Helz_M.m.     ------------------------------------------------------------

CG9425_D.m.   ------------------------------------------------------------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  GSDLDKNDEHVLPSTSSSDNSVQLLNTNQNHYECIALDKSNTHISNSLFYPLGKKHLISK

ptMRDFL_M.m.  ------------PAPENSDL----------------------------------------

PRC285_H.s.   ------------------------------------------------------------

PR285_M.m.    ------------------------------------------------------------

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   F-----------------------------------------------------------

HELZ_H.s.     ------------------------------------------------------------

Helz_M.m.     ------------------------------------------------------------

CG9425_D.m.   ------------------------------------------------------------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  DTEAHISEPEDLGKIRSPPPDHVEVETAREGKQYWNPRNSSELSGLVNTISILKSLCEHS

ptMRDFL_M.m.  -----------LSEARKSPA----IEVSR---------------------ALLECPCEH-

PRC285_H.s.   ------------------------------------------------------------

PR285_M.m.    ------------------------------------------------------------

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   --PSW-------------------------------------------------------

HELZ_H.s.     ------------------------------------------------------------

Helz_M.m.     ------------------------------------------------------------

CG9425_D.m.   ------------------------------------------------------------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  TALDSLEILKKKNTVFQQGTQQTYEPDSPPEVRKPFITVVSPKSPHLHKDSQQILKEDEV

ptMRDFL_M.m.  ------------------------------------------------RASQQ-------

PRC285_H.s.   ------------------------------------------------------------

PR285_M.m.    ------------------------------------------------------------

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ----LTQLVDNSQIK---------------------------------------------

HELZ_H.s.     ------------------------------------------------------------

Helz_M.m.     ------------------------------------------------------------

CG9425_D.m.   ------------------------------------------------------------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ELSEPLQSVQFSSSGSKEETAFQAVIPKQIERKTCDPKPVEFQGHQVKGSATSGVMVRGH

ptMRDFL_M.m.  --------------------------------------PVEFQGHQVKGSATSGVMVRGH

PRC285_H.s.   ----------------------------------------QAAWQDGLVPYQERLLAEYQ

PR285_M.m.    ----------------------------------------QAAWQDGLVPYQARLLAEYQ

MOV10L1_H.s.  --------------------------------------------------SESSLVNNRG

Mov10L1_M.m.  ---------------------------------------------------ESRLANSTE

Armi_D.m.     --------------------------------------------TPLEKNFGATKLTQQS

MOV10_H.s.    -------------------------------------------------YFPATVL--WE

Mov10_M.m.    -------------------------------------------------YFPATVL--WE

CG6701_D.m.   -----------------------------------------FRKDLVVDKFIIVQLRQFY

CG6967_D.m.   -----------------------VCCDGH-------------------------------

HELZ_H.s.     --------------------------------------KQQNENKQLSGSYMETLIEKWM

Helz_M.m.     --------------------------------------KQQSENKQLSGSYMETLIEKWM

CG9425_D.m.   --------------------------------------QKACEKELYGKSYTEQVLDRWI

YER176W_S.c.  ---------------------------------------------NGSGSTNTTGLKKGK

 

 

ptMRDFL_H.s.  SSQLGCSQFPDSTEYENFMTET----PELPSTCMQIDFLQVTSPEENISTLSPVSTFSLN

ptMRDFL_M.m.  SLQRGCTQFPDSIDYENFLTDTCVWTPGLPSTYGQTDFLQVISPEQKIPALSPAPTFSFN

PRC285_H.s.   RSSSEVLVLAETLDGVRV----------------------TCNQPLMYQAQERKTQYSW-

PR285_M.m.    RSSKEVSVMAETIRGVSV----------------------TCHPPPVHQAQEKIQHQWV-

MOV10L1_H.s.  ISPGDCTCKGENGEKDNI----------------------LSRKQMTEPE----------

Mov10L1_M.m.  ISPDGCACKEESREKGNT-------------------------PEKQEPE----------

Armi_D.m.     SMGSSGSGKAVTVTGVNRFITAELWQKESVSLKLTNNLNRTLRLESITVCNDSESQLSV-

MOV10_H.s.    LLGPGESGSEG-------------------------------------------------

Mov10_M.m.    LLGPGESGAEG-------------------------------------------------

CG6701_D.m.   YVYGAQMPLPVNGSGELVFF----------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     NSLSPEKVLSECIEGVKV----------------------EHNPDLSVTVSTKKSHQTW-

Helz_M.m.     SSLSPEKVLSECIEGVQV----------------------EHSPDLSVTVNTKKSHQTW-

CG9425_D.m.   QATAPERVMCERVPDMEA----------------------RCEQQLVTSISSKTSKREW-

YER176W_S.c.  KDHAGQKTKGNDKTGNKN------------------------------------------

 

 

ptMRDFL_H.s.  SRDEDFMVEFSETSLKARTLPDDLHFLNLEGMKKSRSLENENLQRLSLLSRTQVPLITLP

ptMRDFL_M.m.  TRNEDTVLELSEESLKTRTLP---------GLKTIGFQDSKNLQRFPFLSGASAPFATLP

PRC285_H.s.   -----------------------------------------------------------T

PR285_M.m.    ------------------------------------------------------------

MOV10L1_H.s.  -----------------------------------------------------------P

Mov10L1_M.m.  -----------------------------------------------------------P

Armi_D.m.     ---------------------------------------------------------VSP

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     ---------------------------------------------------------TFA

Helz_M.m.     ---------------------------------------------------------TFA

CG9425_D.m.   -----------------------------------------------------------L

YER176W_S.c.  -----------------------------------------------------------P

 

 

ptMRDFL_H.s.  RTDGPPDLDSHSYMINSNTYESSGSPMLNLCEKSAVLSFSIEPEDQNETFFSEESREVNP

ptMRDFL_M.m.  ADDGPAVLDPCSFMIDDDAREPSGSSMLNLCEESG-LSFDLGLEGQGGT----------P

PRC285_H.s.   FAVHSEEPLLHVALLKQEPGADFSLVAPGLPP----------------------------

PR285_M.m.    FTIHSEDPLLHVALLNQEPGAAFSLVAPSLPP----------------------------

MOV10L1_H.s.  GGLVPPGGKTFIVVICDGKNPGRCKELLLLC-----------------------------

Mov10L1_M.m.  GGLIPPGEKTHIVVTCSAKNPGRCKELLLLC-----------------------------

Armi_D.m.     LESKEISSGSEITVTFEIHTQFLGEA----------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   -------VDSHVFMILREQPIVIGFTI---------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     LTCKPARMLYRVALLYDAHRPHFSIIAISAGDSTTQVSQEVPEN----------------

Helz_M.m.     LTCKPARMLYRVALLYDAHRPHFSIIAISAGDSTTQVSQEVPEN----------------

CG9425_D.m.   FQLETKKPLKAVALLQDAHRNHFALKSIKMCKPTESSMELKS------------------

YER176W_S.c.  REAKLNSAGRKNALGKKSNNQPNKG-----------------------------------

 

 

ptMRDFL_H.s.  GDVSL-NNISTQSKWLKYQNTSQCNVA-----TPNRVDKRITDGFFAEAVSGMHFRDTSE

ptMRDFL_M.m.  GGVSLLPKSSTQSKWLKYQNPPQCNST-----APNRLASEVTEGLFAEAVSGLHFSHTSE

PRC285_H.s.   -----------GRLYARGERFRVPSST-----ADFQVGVRVQAASFGTFEQWVVFDFGRR

PR285_M.m.    -----------HQLYAQGKHFCVQSSP-----AQYKVGVLVQAVAFGSFEQWVVFDFGRR

MOV10L1_H.s.  -----------FSDFLIGRYLE--------------VNVISGEESLIAAREPFSWKK---

Mov10L1_M.m.  -----------FSDFLIGRHLE--------------VSVVSSEEALIAVREPFSWKK---

Armi_D.m.     -----------IEKYVLNFDLLKVRRVFTVIVCKTKEEVAEAEKRMIAAEALMAPGRNSQ

MOV10_H.s.    -----------AGTFYIARFLA----------------AVAHSPLAAQLKPMTPFKRTR-

Mov10_M.m.    -----------AETFYIARFLA----------------AVAHSPLAAQLKPTTPFKRPPR

CG6701_D.m.   -----------QGEKYVEQHHF----------------------MRTEALPKASFNIN--

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     -----------CQEWIGGKMAQNGLDH-----YVYKVGIAFNTEIFGTFRQTIVFDFGLE

Helz_M.m.     -----------CQEWIGGKMAQNGLDH-----YVYKVGIAFNTEIFGTFRQTIVFDFGLE

CG9425_D.m.   -----------DQEWLAGSSSQSETSNEDSATLIHEITVEFHTEIYGTFRQAICFDVGQE

YER176W_S.c.  -----------TSRWTIGSDTE------------------------SSREPSISPNEN--

 

 

ptMRDFL_H.s.  RQSDAVNESSLDSVHLQMIKGMLYQQRQDFSSQDSVSRKKVLSLNLKQTSKTEEIKNVLG

ptMRDFL_M.m.  ------SESSVDPVRLQMIKGLLHQQQQDL-----VSRKQAFSLTLNQTCKTQEHETVLG

PRC285_H.s.   -------PVLLQKLGLQLGQGRRPGPCRNL--------ALGHPEEMERWHTGNRHVV---

PR285_M.m.    -------PVLLQKLKLQLGQTHSQGLNGKP--------APSHPQELECWHTGNRHVV---

MOV10L1_H.s.  -------LKSSQALTSAKTTVVVTAQKRNS--------RRQLPSFLPQYPIP--------

Mov10L1_M.m.  -------PKSSQTLVSAKTTVVVTTQKRNS--------RRQLPSFLPQYPIP--------

Armi_D.m.     ERS----RFYANQVWCNKVDVIPGQQIVTK--------RRFVALRLGCFEVPKEL-----

MOV10_H.s.    -------ITGNPVVTNRIEEGERPDRAKGY--------DLELSMALGTYYPPPRL-----

Mov10_M.m.    -------LTRNSVLTNRIEEGERPDRAKGY--------ELELSLALGTYYPPILL-----

CG6701_D.m.   -------PYRLSSKETFKSKGLPPANP-----------PIQVLSALKHED----------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     -------PVLMQRVMIDAASTEDLEYLMHA--------KQQLVTTAKRWDSSSKTIIDF-

Helz_M.m.     -------PVLMQRVMIDAASTEDLEYLMHA--------KRQLVTTAKRWDSSSKTIVDF-

CG9425_D.m.   -------PLLVRHLCVDVLPVNDAEKIEEI-------KRDIINSSATRWDVANTQLTRFE

YER176W_S.c.  -------TTSITKSRNRNKKASKPTLNEKS-------KTTTMPKKLETKN----------

 

 

ptMRDFL_H.s.  GSTCYNYSVKDLQEISGSELCFPSGQKIKSAYLPQRQIHIPAVFQSPAHYKQTFTSCLIE

ptMRDFL_M.m.  SSASKNCRAKDLQEINNSDLCFPNGQKIISAYLPQRQVHIPAVFQSPAHYRQVFTASIIE

PRC285_H.s.   -----------------PGVERTAEQTALMAKYK-GPALALEFNRSSVASGPISPTNYRQ

PR285_M.m.    -----------------LEVDWTPEQEALMAKYK-LPSLALEFNQIVPDWGPISRSNYRQ

MOV10L1_H.s.  -----------------DRLRKCVEQKIDILTFQ------------PLLAELLNMSNYKE

Mov10L1_M.m.  -----------------DRLKKCVEQKIDILTFQ------------PLLAELLNMSNYKE

Armi_D.m.     -----------------RQICLTSERRQEMIKAIEQHY--------SFLTEPLSIKTYMH

MOV10_H.s.    -----------------RQLLPMLLQGTSIFTAPKEIAEIKAQLETALKW-----RNYEV

Mov10_M.m.    -----------------RQLLPTLLQGPSIFTAPKEVAEIKAQLETTLKS-----RNYEV

CG6701_D.m.   -----------------AQMCLASFDNQYQNYCERGREITQENLTGTLRTLLQVEDIERL

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     -----------------EPNETTDLEKSLLIRYQ-IPLSADQLFTQSVLDKSLTKSNYQS

Helz_M.m.     -----------------EPNETTDLEKSLLIRYQ-IPLSADQLFTQSVLDKSLTKTNYQA

CG9425_D.m.   TTIGTHLKTE-------AYLSDLEHERELLERYPCPRAATFTLTQSTIVEKRLTQNNYRS

YER176W_S.c.  -----------------QEKNNGKTKDGKLIYEEGEPLTRYNTFKSTLSYPDL--NTYLN

 

 

ptMRDFL_H.s.  HLNILLFGLAQNLQKALSKVDISFYTSLKGEKLKNA-ENNVPSCHHSQPAKLVMVKKEGP

ptMRDFL_M.m.  HLNILLFELAQRLYKALSKVDISFYTSSKGETMRSG-KNNSPSCHHNQPAKLVMVKKEGP

PRC285_H.s.   RMHQFLYEEEAAQQQLVAKLTLRGQVFLKTALQTPA-----LNMLFAPPGALYAEVPVPS

PR285_M.m.    RMHKFLYEEEAAQQQLVAKLAMKGQVSLKTALETPA-----LGMLFAPPGALYAKVPFHS

MOV10L1_H.s.  KFSTLLWLEEIYAEMELKEYNMSGII-----LRRNG--------------DLLVLEVPG-

Mov10L1_M.m.  KFSTLLWLEEIHAEIELKEYNMS-----RVVLKRKG--------------DLLVLEVPG-

Armi_D.m.     RFRLLLHLEEIECFVNFRNYDRD-----RAHFLRDG--------------EFLTLQIEN-

MOV10_H.s.    KLRLLLHLEELQMEHDIRHYDLESVPMTWDPVDQNP--------------RLLTLEVPG-

Mov10_M.m.    KLRLLLHLEELQMEHDIRHYDLDSVPMTWDPVDQNP--------------RLLTLEVPG-

CG6701_D.m.   QHYLSLKQSEMELHQFGRELSVKMQMGTTSMSVEDI---------LSPGDDVLIINEKGN

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     RLHDLLYIEEIAQYKEISKFNLKVQLQILASFMLTGVSGGAKYAQNGQLFGRFKLTETL-

Helz_M.m.     RLHDLLYIEEIAQYKEVSRFNLKVQLQILASFMLTGVSGGAKYAQNGQLFGRFKLTETL-

CG9425_D.m.   RIHELLSVEEIARYEQIARYNVRTRLTVASNYILTPAGMATSTAKYSLAGELFALMRLGK

YER176W_S.c.  DYSFALFLEQKLENEFVQNFNI-----LWPRNEKDT--------------AFIINVEKN-

 

 

ptMRDFL_H.s.  NKGRLFYTCDGPKADRCKFFKWLEDVTPGYSTQEGARPGMVLSDIKSIGLYLRSQKIPLY

ptMRDFL_M.m.  NKGRLFYTCDKSKDNQCKFFKWLEEVTPGQLPQNTSQSTMVFNDIKSIGSYLRSQKVPVY

PRC285_H.s.   SL--------------------MPDTDQGFLLGRAVSTALVAPVP--------APDNTVF

PR285_M.m.    SL--------------------LPDTDQGFLLSRAVSTALVAPVP--------APNSTVY

MOV10L1_H.s.  ----------------------LAEGRPSLYAGDKLILKTQEYNG---------------

Mov10L1_M.m.  ----------------------LAESRPSLYAGDKLILKSQEYNG---------------

Armi_D.m.     ----------------------LAERRPSLVIGDTLRVINPWSDPD-------SQTTKSY

MOV10_H.s.    ----------------------VTESRPSVLRGDHLFALLSSETH--------QEDPITY

Mov10_M.m.    ----------------------VAESRPSVLRGDHLFALLSSETQ--------QDDPVTY

CG6701_D.m.   ----------------------PKSAVRKMLENNNNVLELALKDFDSILRWARNVD----

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     ----------------------SEDTLAGRLVMTKVNAVYLLPVPKQKLVQTQGTKEKVY

Helz_M.m.     ----------------------SEDTLAGRLVMTRVNAVYLLPVPKEKLVQSQGTKEKVY

CG9425_D.m.   DI--------------------SEDTSPGRLILSNCSSVYI-SKPEDPDSKADPTKRAVY

YER176W_S.c.  ----------------------NNSELEKLLPANLLALGRPAFNERQPFFFCTQDEQKVW

 

 

ptMRDFL_H.s.  EECQLLVRKGFDFQRKQYGKLKKFTTVNPEFYNEP----KTKLYLKLSRKERSSAYSKND

ptMRDFL_M.m.  EECQLLLRRGFDFQRKQCGKLKKLTTVNPDFYSET----KSKIYLKLSRRESSSVYSKGD

PRC285_H.s.   E-----------------VRLERRASSEQALWLLL----PARCCLALGLQPEAR------

PR285_M.m.    Q-----------------VRLEARASSDHALWLLL----PARCCMALGLQAQDS------

MOV10L1_H.s.  ------------------HAIEYISYVTEIHEEDV----TLKINPEFEQAYNFE------

Mov10L1_M.m.  ------------------HVIEYIGYVMEIHEEDV----TLKLNPGFEQMYNFE------

Armi_D.m.     E-----------------GIIHK------VLFDRI----LLKFHSSFQEKYNGE------

MOV10_H.s.    K-----------------GFVHK------VELDRV----KLSFSMSLLSRFVDG------

Mov10_M.m.    K-----------------GFVHK------VELDRV----KLSFSTSLLSRFVDG------

CG6701_D.m.   ------------------GMVGSLDKQPRVYFARILGVSTQRVNITCERQLPDN------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     E-----------------ATIEE--KTKEYIFLRL----SRECCEELNLRPDCD------

Helz_M.m.     E-----------------ATIEE--KTKDYVFLRI----SRECCEELSLRPDCD------

CG9425_D.m.   E-----------------ALIED--KGKNVIYLKL----SAKCVEAMALQADTE------

YER176W_S.c.  Y-----------------IFIKELSIQRGKYVLLV----ELFSWNNLSLPTKNG------

 

 

ptMRDFL_H.s.  LWVVSKTLDFELDTFIACSAFFGPSSINEIEILPLKGYFPSNWPTNMVVHALLVCNASTE

ptMRDFL_M.m.  LWVISKTLDFELDTFIACSAFFGPSSVNEVELLPLKGYFPSNWPTNITVHALLVCNASTE

PRC285_H.s.   ---LVLEVQFQIDPMTFRLWHQAVDTLPE-------------------------------

PR285_M.m.    ---PILEVQFQIDPMTFRFWHQAVDALLE-------------------------------

MOV10L1_H.s.  ----PMDVEFTYNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSS

Mov10L1_M.m.  ----PMDVEFTYNRTTSRRCHYALEQVIHLGVKVLFPEEIILQSPQVTGNWSLAQDTKND

Armi_D.m.     ----DYRLEFYFSRYSFRKQHHAISKIVGVMG----------------------------

MOV10_H.s.    ---LTFKVNFTFNRQPLRVQHRALELTGRWLL----------------------------

Mov10_M.m.    ---LTFKVNFTFNRQPLRVQHRALELTGRWVL----------------------------

CG6701_D.m.   ---TTYTLIFRPLRAVMRYQYRALQQLSFTRHSDV-------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     ---TQVELQFQLNRLPLCEMHYALDRIKD-------------------------------

Helz_M.m.     ---IQVELQFQLNRLPLCEMHYALDRIKD-------------------------------

CG9425_D.m.   ---LEVDIQFQLNRMPYCEWHNAVDKITD-------------------------------

YER176W_S.c.  ----SSQFKLLPTSAQTSRILFAMTRIT--------------------------------

 

 

ptMRDFL_H.s.  LTTLKNIQDYFNPATL------------------------------P-------LTQYLL

ptMRDFL_M.m.  LTTLQNIQDYFNPAAL------------------------------P-------LMPYLL

PRC285_H.s.   -----------EQLVV------------------------------P-------------

PR285_M.m.    -----------EHLVV------------------------------P-------------

MOV10L1_H.s.  GQSTSKK----NRKTM------------------------------TDQAEHGTEERRVG

Mov10L1_M.m.  GQSITNITRNDGQSMTKVTRNDSQSITNIIRNDGQSITNVTRNDGQPITKVTRNNSQSIT

Armi_D.m.     -----------EDFLF------------------------------P-SKVTKRENPQLD

MOV10_H.s.    -----------WPMLF------------------------------P------------V

Mov10_M.m.    -----------WPMLF------------------------------P------------V

CG6701_D.m.   -----------QRILF------------------------------P-------------

CG6967_D.m.   ---------------LPNWM-----QGRPQEPATPTSLSLLNSTIYSNA-----------

HELZ_H.s.     -----------NGVLF------------------------------P-------------

Helz_M.m.     -----------NAVLF------------------------------P-------------

CG9425_D.m.   -----------FRLIF------------------------------P-------------

YER176W_S.c.  -----------NPKFI------------------------------D------------L

 

 

ptMRDFL_H.s.  TTSSPTIVSNKRVSKRKFIPPAFTN-------------VSTKFELLSLGATLKLASELIQ

ptMRDFL_M.m.  AMSQSATVSSKNISKRKFIPPAITS-------------IKTKTEL-HLGATLQLARELIN

PRC285_H.s.   ------DLPTCALPRPWSVPP---------------------------------------

PR285_M.m.    ------DLPACTLPHPWPTPP---------------------------------------

MOV10L1_H.s.  DKDLPVLAPFTAEMSDWVDEI----------------------------QTPKARKMEFF

Mov10L1_M.m.  NITRNDGQPITKNKKTVKDQTKHTTEERHVGTTDQPEKASSTAETMDEIQIPKARDKEFF

Armi_D.m.     VYMKDDDMYLYDSKLEWYNQS---------------------------------------

MOV10_H.s.    APRDVPLLP-SDVKLKLYDRS---------------------------------------

Mov10_M.m.    ASRGVSLLP-SDVKFKLYDRS---------------------------------------

CG6701_D.m.   --GEIPNTPLASGVLQLNNKL---------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     DISMTPTIP-WSPNRQWDEQL---------------------------------------

Helz_M.m.     DISMTPTIP-WSPNRQWDEQL---------------------------------------

CG9425_D.m.   ATELEPSIP-WTPKKQWADSC---------------------------------------

YER176W_S.c.  LLGQKPIKEIYFDNRLKFSSD---------------------------------------

 

 

ptMRDFL_H.s.  VHKLNKDQATALIQIAQMMASHESIEEVKELQTHTFPITIIHGVFGAGKSYLLAVVILFF

ptMRDFL_M.m.  VHRLNKDQATALIQIAQMMASQGSDEDALEPFGHSLPITVIHGVFGAGKSYLLAVVILFL

PRC285_H.s.   LRRGNRKQELAVALIAGWGPGDGR----------RVPPLLIYGPFGTGKTYTLAMASLEV

PR285_M.m.    SFRGNHKQKLAVGLIAGRRPEGTK----------HIPPLLIYGPFGTGKTYTLAMAALEV

MOV10L1_H.s.  NPVLNENQKLAVKRILSGDC--------------RPLPYILFGPPGTGKTVTIIEAVLQV

Mov10L1_M.m.  NPVLNENQKLAVRRILSGDC--------------RPLPYILFGPPGTGKTVTIIEAVLQV

Armi_D.m.     ---LNSIQKRAVFNILRGEA--------------ENIPYVLFGPPGSGKTMTLIETLLQL

MOV10_H.s.    -LESNPEQLQAMRHIVTGTT--------------RPAPYIIFGPPGTGKTVTLVEAIKQV

Mov10_M.m.    -LESNPEQLQAMKHIVRGTT--------------RPAPYIIFGPPGTGKTVTLVEAIKQV

CG6701_D.m.   -ISTNPEQMQAVRQIALSPR--------------LKAPYIVFGPPGTGKTSTIVEAIYQL

CG6967_D.m.   -EQLEAVQRIVAGPSTQ-------------------GPYILFGPPGTGKTTTI-VEAILQ

HELZ_H.s.     DPRLNAKQKEAVLAITTPLAI-------------QLPPVLIIGPYGTGKTFTLAQAVKHI

Helz_M.m.     DPRLNAKQKEAVLAITTPLSI-------------QLPPVLIIGPYGTGKTFTLAQAAKHI

CG9425_D.m.   EPKLNAKQREAVNAITTALSI-------------KLPPILLIGPFGTGKTYTLAQAIKQL

YER176W_S.c.  --KLNRSQKTAVEHVL------------------NNSITILQGPPGTGKTSTIEEIIIQV

 

 

ptMRDFL_H.s.  VQLFEKSEAPTIGNARPWKLLISSSTNVAVDRVLLGLLSLGFENFIRVGSVRKIAKPILP

ptMRDFL_M.m.  VELFEKCDSGTVGNARPWKVLVSSSTNVAVDRVLLGLLSLGFEKFIRVGSVRKIAKPVLP

PRC285_H.s.   IRRPET------------KVLICTHTNSAADIYIREYFH--------------------S

PR285_M.m.    VQQPHT------------KVLICTHTNSAADIYIREYFH--------------------D

MOV10L1_H.s.  HFALPDS-----------RILVCAPSNSAADLVCLRLHE---------------------

Mov10L1_M.m.  HYALPDS-----------RILVCAPSNSAADLVCLRLHE---------------------

Armi_D.m.     VRNLPGA-----------RILVGTPSNSSADLVTKRLID---------------------

MOV10_H.s.    VKHLPKA-----------HILACAPSNSGADLLCQRL-----------------------

Mov10_M.m.    VKHLPKA-----------HILACAPSNSGADLLCQRL-----------------------

CG6701_D.m.   YINRPET-----------HILVLAGSNTACDEVALRLLR--------------------A

CG6967_D.m.   LRLQQPQS----------RILVTAGSNSACDTIALKLCE-----YIESNIRLQEHFAQQK

HELZ_H.s.     LQQQET------------RILICTHSNSAADLYIKDYLH--------------------P

Helz_M.m.     LQQQETS-----------RILICTHSNSAADLYIKDYLH--------------------P

CG9425_D.m.   LTQPEA------------KILICTHSNSAADLYIKEYLH--------------------P

YER176W_S.c.  IERFHAF-----------PILCVAASNIAIDNIAEKIME--------NRPQIKILRILSK

 

 

ptMRDFL_H.s.  YSLHAGSENESEQLKELHA--LMKEDLTPTERVYV------------------RKSIEQH

ptMRDFL_M.m.  YSLHAGSDNESEQLKELNA--LLKEELTPIERVYV------------------RKSIEQH

PRC285_H.s.   HVSGGHPEATPL-RVMYTD--RPLSQTDPVTLQYCCLTD--------------DRQAFRP

PR285_M.m.    YVSSGHPEATPL-RVMYAD--RPPRQTDPTTLQYCCLTE--------------DRQAFRP

MOV10L1_H.s.  ---SKVLQPATMVRVNATC--RFEEIVIDAVKPYC------------------RDGEDIW

Mov10L1_M.m.  ---SKVLKPAAMVRVNATC--RFEETIIDAIKPYC------------------RDGEDIW

Armi_D.m.     --SKALLQGDFIRLVSYNQ--VEKDLIPPEIMSYCATSDVGAVGSCEDKMMVTESGLKLR

MOV10_H.s.    ----RVHLPSSIYRLLAPS--RDIRMVPEDIKPCCNWDA--------------KKGEYVF

Mov10_M.m.    ----RVHLPSSIYRLLAPS--RDIRMVPEDIKTCCNWDA--------------KKGEYVY

CG6701_D.m.   IAKAPQSQPRPLTRIFSANCDRRIDNIDDLLLEYSN-----------------MYTVHFY

CG6967_D.m.   LPEPDHQLIRVYSRSIYEK-GFASVPSLLLKNSNCS------------------KSIYDH

HELZ_H.s.     YVEAGNPQARPL-RVYFRN--RWVKTVHPVVHQYCLISS--------------AHSTFQM

Helz_M.m.     YVEAGNPQARPL-RVYFRN--RWVKTVHPVVHQYCLISS--------------TQSTFQM

CG9425_D.m.   WIEEGLKEATPL-RVYYHK--RWSATVNGVVQKYCITD---------------GVGNFLR

YER176W_S.c.  KKEQQYSDDHPLGEICLHN--IVYKNLSPDMQVVANKT---------------RRGEMIS

 

 

ptMRDFL_H.s.  KLGTNRTLLKQVR----------VVGVTCAACPFPCMNDLK----FPVVVLDECSQITEP

ptMRDFL_M.m.  KLGTNRVLLKQVR----------VVGVTCAACAFPCLNDLK----FPVVVLDECSQMTEP

PRC285_H.s.   PTRAE---LARHR----------VVVTTTSQAREL---RVPVGF-FSHILIDEAAQMLEC

PR285_M.m.    PTGPE---LVHHR----------LVVTTTSQAREL---QVPAGF-FSHIFIDEAAQMLEC

MOV10L1_H.s.  K-------ASRFR----------IIITTCSSSGLFYQIGVRVGH-FTHVFVDEAGQASEP

Mov10L1_M.m.  R-------ASRFR----------IIITTCSSAGLFYQIGVRVGY-FTHVFVDEAGQASEP

Armi_D.m.     CQAKF---IGTHR----------ITISTCTTLGNFLQLGFPAGH-FTHVLFDEAGQCTEP

MOV10_H.s.    PAKKK---LQEYR----------VLITTLITAGRLVSAQFPIDH-FTHIFIDEAGHCMEP

Mov10_M.m.    PAKKH---LQQYR----------VLITTLITASRLVSAQFPIDH-FTHIFIDEAGHCMEP

CG6701_D.m.   PAVQA---VHQYR----------IVICTLSLAGKLSTGGFAANNVYTHVFVDEAAASTEA

CG6967_D.m.   IKASR---IVKYG---------IIVATLCTVARLVTDTLGRYNF-FTHIFIDEAGASTEP

HELZ_H.s.     PQKED---ILKHR----------VVVVTLNTSQYLCQLDLEPGF-FTHILLDEAAQAMEC

Helz_M.m.     PQKED---ILKHR----------VVVVTLSTSQYLCQLDLEPGF-FTHVLLDEAAQAMEC

CG9425_D.m.   PTVED---IMRHR----------IVVVTLSISMELATLGLPKGL-FTHIFLDEAAQAMEC

YER176W_S.c.  KSEDTKFYKEKNRVTNKVVSQSQIIFTTNIAAGGRELKVIKEC---PVVIMDEATQSSEA

 

 

ptMRDFL_H.s.  ASLLPI-ARF-------ECEKLILVGDPKQLPPTIQGSDAAHENGLEQTLFDRLCL-MGH

ptMRDFL_M.m.  ASLLPI-ARF-------QCEKLILVGDPKQLPPTIQGSDAAHENGLEQTLFDRLCL-MGH

PRC285_H.s.   EALTPL-AYAS------HGTRLVLAGDHMQVTPRLF-S-VARARAAEHTLLHRLFL---C

PR285_M.m.    EALIPL-SYAL------SLTRVVLAGDHMQVTPRLF-S-VPRDKSARHTLLHRLFL---Y

MOV10L1_H.s.  ECLIPL-GLMS-----DISGQIVLAGDPMQLGPVIK-SRLAMAYGLNVSFLERLMS-RPA

Mov10L1_M.m.  ECLIPL-GLIS-----DINGQIVLAGDPMQLGPVIK-SRLAMAYGLNVSMLERLMS-RPA

Armi_D.m.     ETMVPI-VMLT-----KKRSQVVLSGDPRQLQSIVT-SRIASKMGFSISFLERLLE-RSP

MOV10_H.s.    ESLVAIAGLMEVKETGDPGGQLVLAGDPRQLGPVLR-SPLTQKHGLGYSLLERLLTYNSL

Mov10_M.m.    ESLVAIAGLMDVKETGNPGGQLVLAGDPRQLGPVLR-SPLALKHGLGYSLLERLLAYNSL

CG6701_D.m.   EVLMGITCTLS------PTLNLILSGDHKQLGPVLQ-SQRANEWGLGLTLFERLLQ-RKC

CG6967_D.m.   EALIGI-MGIK----QTADCHVILSGDHKQLGAVIKSNRAASL-GLSRSLMERLLQ-SDC

HELZ_H.s.     ETIMPL-ALAT------QNTRIVLAGDHMQLSPFVY-SEFARERNLHVSLLDRLYE---H

Helz_M.m.     ETIMPL-ALAT------KNTRIVLAGDHMQLSPFVY-SEFARERNLHVSLLDRLYE---H

CG9425_D.m.   EAIMPL-ALAN------DSTRIVLAGDHMQMSPELF-SAFAKERKLHISLLERLYD---H

YER176W_S.c.  STLVPL-SLP-------GIRNFVFVGDEKQL------SSFSNIPQLETSLFERVLS-NGT

 

 

ptMRDFL_H.s.  KP-----------------ILLRTQYRCHPAISAIANDLFYKGA-------LMNGVTEIE

ptMRDFL_M.m.  KP-----------------VLLRTQYRCHPAISAIANDLFYEGS-------LVNGISERE

PRC285_H.s.   YQQETH------EVARQSRLVFHENYRCTDAIVSFISRHFYVAKGNPI---HARGKVPPH

PR285_M.m.    YQQEAH------KIAQQSRIIFHENYRSTAAIINFVSHHFYLAKGNPI---QASGKVPRH

MOV10L1_H.s.  YQRDENAFGACGAHNPLLVTKLVKNYRSHEALLMLPSRLFYHREL------EVCADPTVV

Mov10L1_M.m.  YLRDENAFGACGAYNPLLVTKLVKNYRSHSALLALPSRLFYHREL------EVCADPKVV

Armi_D.m.     YRKDLQRFPESSGYNPLVLTKLLYNYRALPSIMSIYSRLFYDDELIPVLSEKDSRESRLL

MOV10_H.s.    YKKGPD------GYDPQFITKLLRNYRSHPTILDIPNQLYYEGEL------QACADVVDR

Mov10_M.m.    YKKGPN------GYDPQFITKLLRNYRSHPTILDIPNQLYYDGEL------QACADVVDR

CG6701_D.m.   YQVEED-----GSYNASVQTRLIRNFRSHPEIVSLYNNMYYEGHL------RTEAPMEIV

CG6967_D.m.   YKSDEN-----GNYDRNRQMRLCRNYRSHPQIVRLFNELYYNGEL--------KAQAPAM

HELZ_H.s.     YPAEF-----------PCRILLCENYRSHEAIINYTSELFYEGKL------MASGKQPAH

Helz_M.m.     YPAEF-----------PCRILLCENYRSHEAIINYTSELFYEGKL------MASGKQPAH

CG9425_D.m.   YPSNF-----------PCKILLCENYRAHEAIIRFTSELFYEQKL------VASGKQPRH

YER176W_S.c.  YKNP---------------LMLDTQYRMHPKISEFPIKKIYNGE-------LKDGVTDEQ

 

 

ptMRDFL_H.s.  RSPLLEW----------LPTLCFYNV-KGLEQIERDN-------SFHNVAEATFTLKLIQ

ptMRDFL_M.m.  RSPVLEW----------LPTLCFYNV-TGAEQVEREN-------SFVNVAEATFTLKLIQ

PRC285_H.s.   PRH--------------YPLM-FCHV-AGSPDRDMSMA------SWLNLAEIAQVVEKVQ

PR285_M.m.    PQH--------------YPLM-FCHV-AGSPEQDMSMT------SWLNSAEVTQVVEKVR

MOV10L1_H.s.  TSL-LGWEK---LPKKGFPLI-FHGV-RGSEAREGKSP------SWFNPAEAVQVLRYCC

Mov10L1_M.m.  TSL-LGWEK---LPRKGFPLI-FHGV-RGNEAREGRSP------SWFSPAEAVQVMRYCC

Armi_D.m.     SKLRCVFESEKDIP-QAHGTF-FYGI-IGENRQNNDSP------SWFNPQEVREVFLMTI

MOV10_H.s.    ERF-CRWAG---LPRQGFPII-FHGV-MGKDEREGNSP------SFFNPEEAATVTSYLK

Mov10_M.m.    ERF-CRWEG---LPQQGFPII-FHGV-MGKDEREGNSP------SFFNPEEAATVTSYLK

CG6701_D.m.   CRF-HNWFY---LPNATFPIM-FHSV-FGTTMNTKSSV------SLCNNKEIDVVMDYVK

CG6967_D.m.   DVNLAANWSV--LTNPQFPII-FQAT-HGVTNREQNST------SSYNNLEAEVICWYVK

HELZ_H.s.     KDF--------------YPLT-FFTA-RGEDVQEKNST------AFYNNAEVFEVVERVE

Helz_M.m.     KDF--------------YPLT-FFTA-RGEDVQEKNST------AFYNNAEVFEVVERVE

CG9425_D.m.   DRF--------------YPLT-FFTT-RGEDVQDKNST------AFYNNAEVYEVVERVS

YER176W_S.c.  KAW----------PGVQHPLF-FYQCDLGPESRVRSTQRDIVGFTYENKHECVEIVKIIQ

 

 

ptMRDFL_H.s.  SL-------IASGIAGSMIGVITLYKSQMYKLCHLLSAV---------------------

ptMRDFL_M.m.  SL-------MASGVESCMIGVITLYKSQMYKICNLLSAV---------------------

PRC285_H.s.   EA-YNTWPSCWGGREQRCICVVS-HGAQVSALRQELRRR---------------------

PR285_M.m.    EI-YNTWPHCWGPREQRHICAVS-HGAQVSALRQELRRR---------------------

MOV10L1_H.s.  LL----AHSISSQVSASDIGVITPYRKQVEKIRILLRNV---------------------

Mov10L1_M.m.  LL----ARSVSSQVSSKDIGVITPYRKQVEKIKILLRNV---------------------

Armi_D.m.     AL-------YRANVTADQIGIITPYQKQVKMLRSMFIGT---------------------

MOV10_H.s.    LLLAPSSKKGKARLSPRSVGVISPYRKQVEKIRYCITKL---------------------

Mov10_M.m.    QLLAPSSKKGKARLSPRNVGVISPYRKQVEKIRYCITKL---------------------

CG6701_D.m.   DL--MYFGLNGEKLLQTDIGIISPYKNQYQRIQEQLNMR---------------------

CG6967_D.m.   RL------INDRVVGQEDVGIVAPYTAQGKLVTKLLQSK---------------------

HELZ_H.s.     EL-RRKWPVAWGKLDDGSIGVVTPYADQVFRIRAELRKK---------------------

Helz_M.m.     EL-RRKWPVAWGKLDDGSIGVVTPYADQVFRIRAELRKK---------------------

CG9425_D.m.   EL-RKRWPSAWGKLNDTSIGIMTPYSDQVFRIRSELRKR---------------------

YER176W_S.c.  IL------MLDKKVPLEEIGVITPYSAQRDLLSDILTKNVVINPKQISMQQEYDEIELFN

 

 

ptMRDFL_H.s.  ---------D---FHHPDIKTVQVSTVDAFQGAEKEIIILSCVRTRQ-------------

ptMRDFL_M.m.  ---------D---VGHPDVKAVQVSTVDAFQGAEKEITILSCVRTRQ-------------

PRC285_H.s.   ---------D--------LGQVSVGSFEILPGRQFRVVVLSTVHTCQSLLSPGALAPE--

PR285_M.m.    ---------N--------LGEVSVGSFEILPGREFRVVVLSSVHNRNSLLSPGAPTSE--

MOV10L1_H.s.  ---------D--------LMDIKVGSVEEFQGQEYLVIIISTVRSNEDRFEDD-------

Mov10L1_M.m.  ---------D--------LTDIKVGSVEEFQGQEYLVIVISTVRSNEDRFEDD-------

Armi_D.m.     ---------D--------VVMPKIGSVEEFQGQERDIILISTVRSSEEILRMDA------

MOV10_H.s.    ---------DRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDL------

Mov10_M.m.    ---------DRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDL------

CG6701_D.m.   ---------N--------WSQIDCGSVELFQGKEKHVIIVSFVRSFTPK-----------

CG6967_D.m.   -----------------GYPNVEVGSVETYQGREKTIIIASLVKSFTN------------

HELZ_H.s.     ---------R--------LSDVNVERVLNVQGKQFRVLFLSTVRTRHTC-KHKQTPIKKK

Helz_M.m.     ---------R--------LSDVNVERVLNVQGKQFRVLFLSTVRTRHTC-KHKQTPIKKK

CG9425_D.m.   ---------R--------MGGISVERVLNVQGKQFRAVFLSTVRTRRTCMPQGSAPGSAS

YER176W_S.c.  AAGSQGTAGSLQNNVINIINGLHVATVDSFQGHEKSFIIFSCVRNNTEN-----------

 

 

ptMRDFL_H.s.  ------------VGFIDSEKRMNVALTRGKRHLLIVGNLACL-RKNQL---WGRVIQHCE

ptMRDFL_M.m.  ------------VGFIDSEKRMNVALTRGRRHLLIVGSLSCL-RKNRL---WGRVIQHCE

PRC285_H.s.   --------------FFTDARVLNTVLTRAQSQLVVVGDAVALCSFGACGKLWESFIRECV

PR285_M.m.    --------------FFTEPRVLNTVMTRAQSQLVAVGDAVALCSSGACRNLWRSFIRECI

MOV10L1_H.s.  ---------RYFLGFLSNSKRFNVAITRPKALLIVLGNPHVL-VRDPC---FGALLEYSI

Mov10L1_M.m.  ---------RYFLGFLSNSKRFNVAITRPKALLIILGNPHVL-VRDPC---FGALLEYSV

Armi_D.m.     ---------RFSLGFVRCSKRLNVAVSRARAMMIIFGNPHLL-AVDEC---WRQLILFCV

MOV10_H.s.    ---------DFNLGFLKNPKRFNVAVTRAKALLIIVGNPLLL-GHDPD---WKVFLEFCK

Mov10_M.m.    ---------DFNLGFLKNPKRFNVAVTRAKALLIVVGNPLLL-GHDPD---WKTFLEFCK

CG6701_D.m.   ------------LGFLNNERRLNVLLSRPISLLILIGNPRTL-SQNSD---FQHIIEMCR

CG6967_D.m.   ------------MGFMCNPRRVNVLLSRAKALLILVGNPVTL-RHHSD---FKFVINECK

HELZ_H.s.     EQLLEDSTEDLDYGFLSNYKLLNTAITRAQSLVAVVGDPIALCSIGRCRKFWERFIALCH

Helz_M.m.     EQLLEDSTEDLDYGFLSNYKLLNTAITRAQSLVAVVGDPVALCSIGRCRKFWERFIALCH

CG9425_D.m.   TTSIGDA--DADYGFLSNSKLLNTAITRAQSLVAVVGDPVALCSIGRCRKVWERFIEICD

YER176W_S.c.  -----------KIGFLRDKRRLNVALTRAKHGLIVVGNKNVLRKGDPL---WKDYITYLE

 

 

ptMRDFL_H.s.  GREDGL------------------------------------------------------

ptMRDFL_M.m.  GREDGL------------------------------------------------------

PRC285_H.s.   ERHSVCPEGLSMEQVE---QGVAQRRRWPP-----RGTQAGAAGNWEAAPEPVGDLAEEQ

PR285_M.m.    EHHSAFPEELSLEQIE---QGVAQRQNWASLTLKARGPETEQKS---MAQGPQRLIAEGT

MOV10L1_H.s.  TN----------------------------------------------------------

Mov10L1_M.m.  SN----------------------------------------------------------

Armi_D.m.     KNNAYF------------------------------------------------------

MOV10_H.s.    EN----------------------------------------------------------

Mov10_M.m.    EN----------------------------------------------------------

CG6701_D.m.   NRKTLV------------------------------------------------------

CG6967_D.m.   KHGTYLL-----------------------------------------------------

HELZ_H.s.     ENSSLH--GITFEQIKAQLEALELKKTYVL------NP---------LAPE---------

Helz_M.m.     ENHSLH--GITFEQIKAQLEALELKKTYVL------NP---------LAPE---------

CG9425_D.m.   EHKSLF--GLTWSNLRSQLDGVELKRGYVL------NP---------LAPE---------

YER176W_S.c.  EQEVIF------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   AAVVTAMVKAEPGDEALSPASRDITATTAQTEAAAAPAGDAVKEDVVPGACAAGAAAAAG

PR285_M.m.    MVTVKAETRAE---------------AAAKAQTAAVAAEDTASGNSASRDAAAEVSTLEG

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     --FIPRALRLQ-----------------------H--SGSTNKQQQSPP---------KG

Helz_M.m.     --FIPRALRLQ-----------------------H--SGNSSRQQQSPP---------KV

CG9425_D.m.   --FVPRALQPE-----------------------AYLREQAALYLNGPQ---------HG

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   VESTEAEDAEADFWPWDGELNADDAILRELLDESQKVMVTVGEDGLLDTVARPESLQQAR

PR285_M.m.    --GMSEEDSESDFWPSDWELNADDAILKELLDESQQVTVTVREDGLLDTVVCSAP-QKAR

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     KSLHHTQN--DHFQN-DGIVQPNPSVLIGN---------------------------PIR

Helz_M.m.     KSLYHPQS--DHFQS-DGIVQPNPSVLIGN---------------------------PIR

CG9425_D.m.   HGGHGPPGPPAHFANAAGMLGPGPAAAAHQMNQMAAAMAANQQQ------------LTAH

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   LYENLPPAALRKLLHAEPERYRHCSFVPETFERASAIPLDDASSGPIQVRGRLDCGMAFA

PR285_M.m.    EYTNLPSSVLWKFLRSNSKQFRRCSFLQETFERALATPLDDMASSPIQVRGRLNCGMAFT

MOV10L1_H.s.  --------------------------------------------------------GVYM

Mov10L1_M.m.  --------------------------------------------------------GVYT

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    --------------------------------------------------------GGYT

Mov10_M.m.    --------------------------------------------------------GGYT

CG6701_D.m.   ----------------------------------GEQYLNEDFITNKKTGANNVNKGGAA

CG6967_D.m.   ---------------------------KKRDSGQRPHILIKADESNEESSSEPEDEDDKL

HELZ_H.s.     AYTPPPP-----L-----------GPHPNLGKSPSPVQRIDPHTGT----SILYVPAVYG

Helz_M.m.     AYTPPPP-----L-----------GPHPNLGKSPSPVQRIDPHTGT----SILYVPAVYG

CG9425_D.m.   MYSTHMA-----MMAAAVGGKSGNGPGPGTGGGPGPGPGPPPHYGG----G-----GGGG

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   GDEVLVQLLS---GDKAPEGRLRGRVLGVLKRKRHELAFVCRMDTWDPRIMVPINGSVTK

PR285_M.m.    GDEVLVQILGPAGDDRCVPGSLQGRVMGVLKRRRHELAFVCRMDEWDPRIMIPINGSVTK

MOV10L1_H.s.  G-----------------------------------------------------------

Mov10L1_M.m.  G-----------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    G-----------------------------------------------------------

Mov10_M.m.    G-----------------------------------------------------------

CG6701_D.m.   GDQPASGL----------------------------------------------------

CG6967_D.m.   IPSYARMQQHTDAAIHKIKAHPTNENDQLANSFKISMSKLSI------------------

HELZ_H.s.     GNVVMSVPLP------VPWTGYQGRFAV------------------DPRIITHQAAMAYN

Helz_M.m.     GNVVMSVPLP------VPWTGYQGRFAV------------------DPRIITHQAAMAYN

CG9425_D.m.   GHMGMRGP-P------PPAPHLRGMPPG------------------GPPPTQQPGGAG--

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   IFVAELKDPSQVPIY------SLRKGRLQRVGLERLTAEARHSRLFWVQIVLWRQGFYYP

PR285_M.m.    IFVAEMKDPQQVPIH------RLIQGQVQRVRHETLKPEDRSTRLFWVRIVLWRERFYYP

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     MNLLQTHGRGSPIPYGLGHHPPVTIGQPQNQHQEKDQ-HEQNRN----------------

Helz_M.m.     MNLLHTHGRGSPIPYGLGHHPPVSLGQPQSQHAEKDQ-QEQNRN----------------

CG9425_D.m.   ------GGGGPPPPY--GQYPAMQHWRPPQQGQNQGPGQQPPQN----------------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   LGIVREVLPEASTWEQGLRILGLEYSLRVPPSDQATITKVLQKYHTELGRVAGRREDCRA

PR285_M.m.    LGIVLEVLPKAITWEQGLYILDLEHGLKAHTPDPASVSKALQRYRSELNTAAGHREDYRH

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     --------GKSDTNNSGPEI----N--KIRTPEK--------------------------

Helz_M.m.     --------GKTDTNNPGPEI----N--KIRTPEK--------------------------

CG9425_D.m.   --------PNASLWGPPPQT----NPWSVLPPSK--------------------------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   FLTFTVDPQGACNLDDALSVRDLGPRCEVAVHITDVASFVPRDGVLDVEARRQGAAFYAP

PR285_M.m.    FLTFTVDPQGACNLDDALSVRDLGPVYEVAVHIADVASLVPKDGALDVEARQQGTVFYAP

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ---------------------------------------------------RQPLKRKNH

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     ------KPT---------------------------------------EPKQVDLESNPQ

Helz_M.m.     ------KPT---------------------------------------EPKQVDLESNPQ

CG9425_D.m.   ------QPQ---------------------------------------QPQPPPVSA--P

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   GREPVPMLPASLCQDVLSLLPGRDRLAI-SLFLTMEKASGQLKSLRFA--PSVVQSDRQL

PR285_M.m.    NREPVLMLPASLCQDALSLLPGQDRLAI-SLFLTMEKGGGQIKSLRFA--PSIIRSDRQL

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   AKNPVQDAKIFYSKNELLNLGNECQRKK--------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     NRSPESRPSVVYPSTKFPRKDNLNPRHI-NLPLPAPHAQYAIPNRHFHPLPQLPRPPFPI

Helz_M.m.     NRSPESRPGVVYSNTKFPRKDHLNPRHINNLPLPAPHAQYAIPSRHFHPLPQLPRPPFPA

CG9425_D.m.   GRGPGPLPPPLNANPSLPLRGG-------SVPPPPPNASTA---------AHLLRNPSEL

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   SYEEAEEVIRQHPGAGRELPARLDSVDACVVAACYFSRLLRRHRLRSDCFYEQPDEDGTL

PR285_M.m.    SYEEAEELIKRHPGAGLELPAHLDSVEACVVAACYFSWMLRRQRLSAACYYEPPDEDSVL

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     P--QQHTLLNQQQNN---LPE---------------------------------------

Helz_M.m.     S--QPHTLLNQQQNN---LPEQPNQMAP--------------------------------

CG9425_D.m.   GYLAKKSLYNHGQ-A---LPHHQLY-----------------------------------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   GFRAAHIMVKEYMIQFNRLVAEFLVGSECTRTVTPLRWQPAPRSQQLKALCEKHGDRVPL

PR285_M.m.    GFRTAHIMVQEYMIQFNSHVAEFLVSNKHTQTLTPLRWQPTPSRQQLDSVFKKYRGLVPL

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     --------------------------------------QPNQIPPQPNQVVQQQSQLNQQ

Helz_M.m.     ------------------------QPNQVAPQPNQMTPQPNQVAPQPNQVVQQQSQAPPQ

CG9425_D.m.   --------------------------------------GPGPGPPPPPS--QQQPQAPPM

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   SLHLGHHLHGGGGSPPDTRLHLLASLWKQVQFAARTQDYEQMVDLVTTDDMHPFLAPAGR

PR285_M.m.    SLHLCH--HSNTDYTPNKQLHLLTSLWKQVQLAAGTQDYSQMVDLIAADDMHPSLAPACL

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     PQ------Q-----PP------------------------------------PQLSPA--

Helz_M.m.     AP------Q-----PA------------------------------------PQLSPA--

CG9425_D.m.   GM------QRGSSVPN------------------------------------GPMSPM--

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   DLRKALERSAFGRCARGHQQQGGHYSLQVDWYTWATSPIRRYLDVVLQRQILLALGHGGS

PR285_M.m.    DLRRALGRSVFGRSSQGKQQPAVHHSLQVDWYTWATSPIRRYLDVVLQRLILLALGHRGS

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     ---------------------------------YQAGPNNAFF-------------NSAV

Helz_M.m.     ---------------------------------FQAGPTNAFF-------------NNAV

CG9425_D.m.   ---------------------------------ENGPPPPPYLR------------HNGS

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   AYSARDIDGLCQAFSLQHALAQSYQRRARSLHLAVQLKAQPLDKLGFVVDVEAGSRCFRL

PR285_M.m.    TYSNRDIDGLCLDFSRQYASAQSYQRRAYSLHLAIQLKSQPQNKLGFVVDVEMGARCFKV

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     AH-------------------------------------RPQSP----------------

Helz_M.m.     AH-------------------------------------RPQSP----------------

CG9425_D.m.   GY-------------------------------------NPGAP----------------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   LFPSNRETLPDPCPVPYGSLQLAEHPHALAGRPGLRLLWRRRVYSAQGSSPPLPLPGTVP

PR285_M.m.    LFPINRETLPDPCPIHYHSLQLAEHPQELVSQTGVRLVWRRRMYSVQASKLPLPLLGTSL

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     --PAEAVIPEQQPP-PM--LQEGHSPLRAIAQPG----------P----ILPSHLNSFID

Helz_M.m.     --AAEAVGPEQPPP-PG--LPDGHSPLRAITQPG----------P----ILASPLNNFVD

CG9425_D.m.   --PPPPQQQPQPPPNPF--MYAGKQPSPSSMRFG----------PMTHELLPPNVSIYDM

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   DPHTLAVETALWKQLLELVELQRWPEAAALIQEKGEASQRRELVQVQRSHCGHFLEVARE

PR285_M.m.    DPHTQTVDAALWMKLLMLLKEQRWPEIAALIQEQDKRFHPREKVKIHQSRCGHFVEVVYE

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     ENPSG-------LPIGEALD---------------------------RIHGSVALETLRQ

Helz_M.m.     ESSPG-------LPIEEALD---------------------------GVHGSVALETLRQ

CG9425_D.m.   AFNPKDEQYKWYVKLLETVG---------------------------QDGANKFAEMLRQ

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   LGSGDTLQVQLGTSLQHGFLVPSPQLWTVAPGFSLCLEHVERPGDCFSGRVYRAPRDRYR

PR285_M.m.    LGSGDTLQVQLGSSLQRGFLAPTLKLWTVVPGFSLCLEHMERPGDCFSSHVHQALQDQYL

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     Q-------------------QARFQQWS---------EHH-----AFLS-----------

Helz_M.m.     Q-------------------QARLQQWS---------EHH-----AYLS-----------

CG9425_D.m.   V-------------------MATMQQQQ---------QQHKPPQPPMAN-----------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   DVDEYACVWEPFCALESATGAVAENDSVTLQHLSVSWEASRTPQGQLQGAFRLEAAFLEE

PR285_M.m.    QVGEYSGAWGPRCALESLTNAVTENDSIVLHDVHISWD---TSQGQLQGTFQLEAAFLQE

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     ------------------------QGSVPYPHHHHPHLQHL-PQP---------------

Helz_M.m.     ------------------------QGGIPYSHHHHPHLPHL-PHT---------------

CG9425_D.m.   ------------------------NPMLNNPHVQRPQYPMMYPQG---------------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   NCADINFSCCYLCIRLEGLPAPTASPRPGPSSLGPGLNVDPGTYTWVAHGQT--------

PR285_M.m.    KCINIHFGCCYLCIRLEGLPLPLDSSLPGPSGLGPFLNIDPNTYTWVAHGLSGDWDHELA

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     ---------------------PLGLHQPPVR-----------------------------

Helz_M.m.     ---------------------PIGLHQPPVR-----------------------------

CG9425_D.m.   ---------------------QQQQQQQPPQ-----------------------------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   -QDWDQERRADRQEAPRRVHLFVHHMGMEKVPEEVLRPGTLFTVELLPKQLPDLRKEEAV

PR285_M.m.    GGDWDQENVDDRQEAPKQVYFLIHHMTMEKVPEEVLRPSARFTVEVLSKQLPDLRKEEAV

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     -ADWKLTSSAEDEVETTYSRF-----------QDLIR-------ELSHRDQSETR-----

Helz_M.m.     -AEWKVAGRADDETETTFSRF-----------QDLLR-------ELSHRDQGDTG-----

CG9425_D.m.   -QSVDASPPLENFNQQIDLVF-----------NSIMN-------GANDVAQPILR-----

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   RGLEEASPLVTSIALGRPVPQ-------------------------------PL------

PR285_M.m.    RQLKTASPLVISIALGLPIPEIRWPISGPRRLVSELRWPIPGPRRPVSEPHRPMSGPCGP

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     ----ELAEM--------PPPQ---------------------------------------

Helz_M.m.     ----ELAEM--------PPPQ---------------------------------------

CG9425_D.m.   ----DVLGMVAGTGNAPGPPL---------------------------------------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   ----CRVIP------------------SRFLERQTYNIPGGRHKLNPSQNVAVREALEKP

PR285_M.m.    ISEPCRSIPEPCRGNWPRQHSFHKASTSRFLERQNYNIPAGHHKLNQSQDRAVRSALQKQ

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   -----------------------------------------------------SELETIF

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     ---------------------------SRLLQY--------------------RQVQSRS

Helz_M.m.     ---------------------------SRLLQY--------------------RQVQPRS

CG9425_D.m.   ---------------------------SNGLNG--------------------VDLQQQQ

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   FTVIQGPPGTGKTIVGLHIVFWFHKSNQEQVQPGGPPRGEKRLGGPCILYCGPSNKSVDV

PR285_M.m.    FTVIQGPPGTGKTVVGFHIVYWFHRSNQEQMPTDSSPSGEEQLGGPCVLYCGPSNKSVDV

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   DELPKVPRSVDHDLDEVRSIEAQLKDFQLETKQDAAGTSILVTNAPVTNAAAPSVIPRAG

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     PPAVPSPPSSTDH----SSHFSNFNDNSRDIEVASNPAFPQRLPPQ--IFNSPFSLPSEH

Helz_M.m.     PPAVPSPPSSTDH----SSQFANFNDSSRDIEVANSPAFPQRLPPQ--LFGSPFSLPSEH

CG9425_D.m.   -----QQQQQQQQ----SRLFAMMQQQQQQQQ-------QQQAKPP--L--GPGPLYPNH

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   LAGLLLRR-MELKPLRVYSEQAEASEFPVPRVGSRKLLRKSPREGRPNQSLRSITLHHRI

PR285_M.m.    LGGLLLRRKTEMKPLRVYGEQAEATEFPLPGVSNRSLFGKTSQEGRPNQSLRSITLHHRI

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   LM----------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     LAPPPLKY------------LAPDGAWTFANLQQNHLMGPGFPYGLP-------PLPHRP

Helz_M.m.     LAPPPLKY------------LAPEGAWNFANLQQNHLIGPGFPYGLP-------PLPPRP

CG9425_D.m.   LGGPGLHQ------------APPNGGGNLSGVGNTNFMGNA---GNA-------LLNDKP

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   RQAPNPYSSEIKAFDTRLQRGELFSREDLVWYKKVLWEARKFELDRHEVILCTCSCAASA

PR285_M.m.    RQAPNPYAAEIRKFDAQLREGKIFSKEDLRVYRRVLGKARKHELERHSVILCTCSCAASK

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   ------------------------------------------------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     PQNP-------------------FVQ--IQNHQHAIGQEPFHPLSSRTV-----SSSSLP

Helz_M.m.     PQNP-------------------FIH--IQNHQHAAGQEPFHPLSSRTV-----SASSLP

CG9425_D.m.   YNNV-------------------GMHNNVGLNIGGAGVAGHNSNNNNGM-----LTNGNN

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   SLKILDVRQILVDEAGMATEPETLIPLVQFPQA-EKVVLLGDHKQLRPVVKNERLQNLGL

PR285_M.m.    SLKILNVRQILIDEAGMATEPETLIPLVCFSKTVEKVVLLGDHKQLRPVVKSEQLQSLGM

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------------------------------------

Mov10_M.m.    ------------------------------------------------------------

CG6701_D.m.   -----------------------------------------------------KQETPAL

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     SLEEYEPR-------------GPGRPLYQ-----------------RRISSSSVQPCSEE

Helz_M.m.     SLEEYEPR-------------GPGRPLYQ-----------------RRISSSSAQPCVEE

CG9425_D.m.   SV-----------------------PLYR-----------------RQAHTGNGIGGGNG

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  --------------------QHANQYE---------------------------------

ptMRDFL_M.m.  --------------------QHASQCE---------------------------------

PRC285_H.s.   DRSLFERYHEDAHMLDTQYRMHEGICAFPSVAFYKSKLKTWQGLRRPPSVLGHAGKESCP

PR285_M.m.    DRSLFERYHRDAIMLDTQYRMHKDICSFPSVEFYGGKLKTWSDLRRLPSILGHTGKPSCS

MOV10L1_H.s.  -------------------------CDLP-------------------------------

Mov10L1_M.m.  -------------------------CDLP-------------------------------

Armi_D.m.     ------------------------GCDLP-------------------------------

MOV10_H.s.    -------------------------CPFP-------------------------------

Mov10_M.m.    -------------------------CPFP-------------------------------

CG6701_D.m.   HSSSVSRPAIRKPTVSAATPVAKSRSPMPEIPSSSKHPI---------------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     VSTPQDSLAQCKELQD---HSNQSSFNFSSPESWVNTTS--------------------S

Helz_M.m.     ASAPQDSLAQGKESQG---HSNPPAFNFPAPESWANTTS--------------------S

CG9425_D.m.   DYNNMHGMDAGANLIEALFQANNSVVDHSVKSS--DHMH--------------------G

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  -------------------------PQLNHLLKDYFEKQVEEKQKKKSEKEKSKDKSHS-

ptMRDFL_M.m.  -------------------------PQLDHLLKDYLEKQAEEKQKKKEKEKSKDKSH---

PRC285_H.s.   VIFGHVQGHERSLLVSTDEGNENSKANLEEVAEVVRITKQLTLGRTVEPQDIAVLTPYNA

PR285_M.m.    VIFGSVQGHEQKLLVSTEDGNENSRANPEEVTQVVRIIKQLTLDRTVDPKDIAVLTPYNA

MOV10L1_H.s.  -------------------------PALQSLQNCGEGVADPSYPVVPEST----------

Mov10L1_M.m.  -------------------------PELQALQK---------------------------

Armi_D.m.     ----------------------------QMVINQKDEVPVCLETFVPSLNTTDDLN----

MOV10_H.s.    -------------------------AKLD--LQQGQNLLQGLSKLSPSTS----------

Mov10_M.m.    -------------------------AKLD--LQQGQDLLQGLSKLSPSTS----------

CG6701_D.m.   --------------------SMSSNPLSTNTERCVNGVLCGIEAVPPSENKTTRSSAYNH

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     TPYQNIPC-N----------GSSRTAQPRELIAPPKTVKPPEDQLKSENLEVSSSFNYSV

Helz_M.m.     APYQNIPC-N----------GSSRTSQPRELIAPPKTVKPPEDQLKPESGEVSSSFNYSM

CG9425_D.m.   LLYNNFNGLK----------GGGHELDLFQAMAPSVPHSEAANHHQQSSG--SSATTYAA

YER176W_S.c.  ----------------------------------------------------TDLTAY--

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   Q--ASEISKALRREGIAGVAVSSITKSQGS---EWRYVLVSTVRTCAKSDLDQRPTKSWL

PR285_M.m.    Q--AAAISRGLMQRGVTGVTVTSITKSQGS---EWRYVIVSTVRTCPRSDVDQRPTKSWL

MOV10L1_H.s.  -------------GPEKHQEPS--------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    -------------GPHSHDYLPQEREGEGG------------------------------

Mov10_M.m.    -------------GPRRHQNLPQEREGEGG------------------------------

CG6701_D.m.   IPSGNFRFENVRPTPEEVRRFNGANDQRRARPFREPHGNWSNFGWSPPP-----------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     LQHLGQFPPLMPNKQIAESANSSSPQSSAGGKPAMSYASALRAPPKPRPPPEQ-------

Helz_M.m.     LQHLGQFPPLMPNKQIAESANCSSQQSPAGSKPAMSYASALRAPPKPRPPPEQ-------

CG9425_D.m.   V--LSQGPQAVVGGGVGTGPSPGQSQAQAG--VAGSGTGGKVAPAVGRNDLLE-------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  ------------------------------------------------------------

ptMRDFL_M.m.  ------------------------------------------------------------

PRC285_H.s.   KKFLGFVVDPNQVNVAVTRAQEGLCLIGDHLLLRCCPLWRSLLDFCEAQQTLVPAGQVRV

PR285_M.m.    KKFLGFVVDPHQVNVAITRAQEALCIIGDHLLLRCCPLWHRLLDFCEAQHSLVSAEKVRV

MOV10L1_H.s.  ------------------------------------------------------------

Mov10L1_M.m.  ------------------------------------------------------------

Armi_D.m.     ------------------------------------------------------------

MOV10_H.s.    ------------------------------LSLQVEPEWRNEL-----------------

Mov10_M.m.    ------------------------------LPLQVEPEWRNEL-----------------

CG6701_D.m.   ---------------------------RDPTPPRRNKKFNCIIS----------------

CG6967_D.m.   ------------------------------------------------------------

HELZ_H.s.     ----------------AKKSSDPLSLFQE-LSLGSSSGSNGFYSYFK-------------

Helz_M.m.     ----------------AKKGSDPLSLLQE-LSLGSSPGSNGFYSYFK-------------

CG9425_D.m.   --------------------KDPFAAIRE-LG----QATTGFYNYFQ-------------

YER176W_S.c.  ------------------------------------------------------------

 

 

ptMRDFL_H.s.  --------

ptMRDFL_M.m.  --------

PRC285_H.s.   CRRPTMPS

PR285_M.m.    QRKSALSS

MOV10L1_H.s.  --------

Mov10L1_M.m.  --------

Armi_D.m.     --------

MOV10_H.s.    --------

Mov10_M.m.    --------

CG6701_D.m.   --------

CG6967_D.m.   --------

HELZ_H.s.     --------

Helz_M.m.     --------

CG9425_D.m.   --------

YER176W_S.c.  --------