S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Hcs1p
YKL017C
eri-7
CE36108
Ighmbp2 IGHMBP2
Database Links  
Cellular Function Translation

Group Alignment

IGHMBP2_H.s.  MASAAVESFVTKQLDLLELERDAEVEERRSWQENISLKELQSRGVCLLKLQVSSQRTGLY

IGHMBP2_M.m.  MASSTVESFVAQQLQLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLY

C41D11_C.e.   -MIEADKKF----LELVKKNQKQNTNP---------------------------------

YKL017C_S.c.  MNKELASKF----LSSIKHEREQDIQTTSRLLTTLSIQQLVQNGLAINNIHLENIRSGLI

 

 

IGHMBP2_H.s.  GRLLVTFEPR------------RYGSAAALPS-----NSFTSGDIVGLYDAANEGSQLAT

IGHMBP2_M.m.  GQRLVTFEPR------------KFGPAVVLPS-----NSFTSGDIVGLYD-TNENSQLAT

C41D11_C.e.   -----------------------------------------------VYQ----------

YKL017C_S.c.  GKLYMELGPNLAVNDKIQRGDIKVGDIVLVRPAKTKVNTKTKPKVKKVSEDSNGEQAECS

 

 

IGHMBP2_H.s.  GILTRVTQKSVTVAFDESHDFQLSLDRE-NSYRLLKLANDVTYRRLKKALIALKKYHSGP

IGHMBP2_M.m.  GVLTRITQKSVTVAFDESHDLQLNLDRE-NTYRLLKLANDVTYKRLKKALMTLKKYHSGP

C41D11_C.e.   ---YTLEDNPESLTLQDVLESHMTDPIELNSFDSMEKEAGIPFS----------------

YKL017C_S.c.  GVVYKMSDTQITIALEESQDVIATTFYSYSKLYILKTTNVVTYNRMESTMRKLSEISSPI

 

 

IGHMBP2_H.s.  ASSLIEVLFGRSA--PSPASEIHPLTFFNTCLDTSQKEAVLFALS-QKELAIIHGPPGTG

IGHMBP2_M.m.  ASSLIDILLGSST--PSPAMEIPPLSFYNTTLDLSQKEAVSFALA-QKELAIIHGPPGTG

C41D11_C.e.   --------------------------------NEKQRTAIKMALNENRKLVCIQGPPGTG

YKL017C_S.c.  QDKIIQYLVNERPFIPNTNSFQNIKSFLNPNLNDSQKTAINFAI--NNDLTIIHGPPGTG

 

 

IGHMBP2_H.s.  KTTTVVEIILQAVKQGL--KVLCCAPSNIAVDNLVERLA--LCKQRILRLG---HPARLL

IGHMBP2_M.m.  KTTTVVEIILQAVKQGL--KVLCCAPSNIAVDNLVERLA--LCKKRILRLG---HPARLL

C41D11_C.e.   KTFTLTLLLCRLIQQKK--QVVVLAPTREALANI--RM---MTKKTLKRMGIKVHEHALM

YKL017C_S.c.  KTFTLIELIQQLLIKNPEERILICGPSNISVDTILERLTPLVPNNLLLRIG---HPARLL

 

 

IGHMBP2_H.s.  ESIQQHSLDAVLARSDSAQIVADIRKDIDQVFVKNKKTQDKREKSNFRNEIKLLRKELKE

IGHMBP2_M.m.  ESVQHHSLDAVLARSDNAQIVADIRRDIDQVFGKNKKTQDKREKGNFRSEIKLLRKELKE

C41D11_C.e.   DTNEYRD---VINKSDRALMAAEEVRDLRKAFDNGEITENVLDE---------MRQSIIN

YKL017C_S.c.  DSNKRHSLD-ILSKKNT--IVKDISQEIDKLIQENKKLKNYKQRKENWNEIKLLRKDLKK

 

 

IGHMBP2_H.s.  REEAAM-LESLTSANVVLATNTGASADGPLKLLPES----YFDVVVIDECAQALEASCWI

IGHMBP2_M.m.  REEAAI-VQSLTAADVVLATNTGASSDGPLKLLPED----YFDVVVVDECAQALEASCWI

C41D11_C.e.   RVRNEVGAEVIGNVRVAFATIGASFVDFVMKHKKFDPC-----LCIIDEAAQVMEAQTWP

YKL017C_S.c.  REFKTI-KDLIIQSRIVVTTLHGSSSRELCSLYRDDPNFQLFDTLIIDEVSQAMEPQCWI

 

 

IGHMBP2_H.s.  PLL----KARKCILAGDHKQLPPTTVS--HKAALAGLSLSLMERLAEEYGAR-VVRTLTV

IGHMBP2_M.m.  PLL----KAPKCILAGDHRQLPPTTVS--HRAALAGLSRSLMERLAEKHGAG-VVRMLTV

C41D11_C.e.   AVY----KMKRIVMAGDPKQLPALVFT--DEAKAFGLQNSVMDRILEKKNNFSWI-MLEN

YKL017C_S.c.  PLIAHQNQFHKLVLAGDNKQLPPTIKTEDDKNVIHNLETTLFDRIIKIFPKRDMVKFLNV

 

 

IGHMBP2_H.s.  QYRMHQAIMRWASDTMYLGQLTAHSSVARHLLRDLPGVAAT-----EETGVPLLLVDTA-

IGHMBP2_M.m.  QYRMHQAIMCWASEAMYHGQLTSHPSVAGHLLKDLPGVTDT-----EETRVPLLLIDTA-

C41D11_C.e.   QYRSNAKIATWSNTCFYHNQLKTDVKCHEYSLHTILNPQPKKFRNLFD---PLVLIDTSL

YKL017C_S.c.  QYRMNQKIMEFPSHSMYNGKLLADATVANRLLIDLPTVDATPSEDDDDTKIPLIWYDTQ-

 

 

IGHMBP2_H.s.  -----------GCGLFELEEEDEQ----SKGNPGEVRLVSLHIQALVDAGVPARDIAVVS

IGHMBP2_M.m.  -----------GCGLLELEEEDSQ----SKGNPGEVRLVTLHIQALVDAGVQAGDIAVIA

C41D11_C.e.   ERDVEKRLETYEHAVFDTNSINKTKQGFSYANLAEAKIAIGHYQRLLKYGVQPSDIAIIT

YKL017C_S.c.  -----------GDEFQETADEATILG--SKYNEGEIAIVKEHIENLRSFNVPENSIGVIS

 

 

IGHMBP2_H.s.  PYNLQVDLLRQSLVH--------RHPELEIKSVDGFQGREKEAVILSFVRSNRKGEVGFL

IGHMBP2_M.m.  PYNLQVDLLRQSLSN--------KHPELEIKSVDGFQGREKEAVLLTFVRSNRKGEVGFL

C41D11_C.e.   PYKGQTSLVTKLMEEFGAETGYTDFVQTTIGTVDSVQGKEYEVVIFTMVRSNPRKTMGFV

YKL017C_S.c.  PYNAQVSHLKKLIHD------ELKLTDIEISTVDGFQGREKDVIILSLVRSNEKFEVGFL

 

 

IGHMBP2_H.s.  AEDRRINVAVTRARRHVAVICDSRTVN--NHAFLKTLVEYFTQHGEVRTAFEYLDDIVPE

IGHMBP2_M.m.  AEDRRINVAVTRARRHVAVICDSHTVN--NHAFLKTLVDYFTEHGEVRTAFEYLDDIVPE

C41D11_C.e.   SELRRLNVVITRAKRHFMFIGNGYLLAESKKDEIRKLYD-CFKNAKRR------------

YKL017C_S.c.  KEERRLNVAMTRPRRQLVVVGNIEVLQRCGNKYLKSWSEWCEENADVR------------

 

 

IGHMBP2_H.s.  NYSHENSQGSSHAATKPQGPATSTRTGSQRQEGGQEAAAPARQGRKKPAGKSLASEAPSQ

IGHMBP2_M.m.  NYTHEGSQGHSRVP-KPKCPSTSIRKPASDQESGQETRAAPRHGRRKPSEKPPGSHVQSQ

C41D11_C.e.   -----------------------------------------------------------F

YKL017C_S.c.  ------------------------------------------------------------

 

 

IGHMBP2_H.s.  PSLNGGSPEGVESQDGVDHFRAMIVEFMASKKMQLEFPPSLNSHDRLRVHQIAEEHGLRH

IGHMBP2_M.m.  HSSSANGSDRTGGPDRTEHFRATIEEFVASKESQLEFPTSLSSHDRLRVHQLAEEFGLRH

C41D11_C.e.   HPNNAFGEDGNVTDYVSNNFGQDLESFMNYSNDEEMINWCKRFNE---------------

YKL017C_S.c.  ------------------------------------------------------------

 

 

IGHMBP2_H.s.  DSSGEGKRRFITVSKRAPRPRAALGPPAGTGGPAPLQPVPPTPAQTEQPPREQ-------

IGHMBP2_M.m.  DSTGEGKARHITVSRRS---------PASSGSVAPQPSSPPSPAQAEPEPRAEEPVTVVQ

C41D11_C.e.   ------------------------------------------------------------

YKL017C_S.c.  ------------------------------------------------------------

 

 

IGHMBP2_H.s.  -RGPDQPDLRTLHLERLQRVRSAQGQPASKEQQASGQ-QKLPEKKKKKAKGHPATDLPTE

IGHMBP2_M.m.  AHCPVQLDLKALHLERLQRQQSSQAQTAKGQPGGDSRPQKASQKKKKKEPKGPVMALPCE

C41D11_C.e.   -NGPDYRAKKALAWEK----------------REETRLMKTISKVKYEYKRGSTEQLASE

YKL017C_S.c.  --------------------------------------------------------YPNI

 

 

IGHMBP2_H.s.  EDFEALVSAAVKADNTCGFAKCTAGVTTLGQFCQLCSRRYCLSHHLPEIHGCGERARAHA

IGHMBP2_M.m.  EDFDALVSAVVKADNTCSFSKCSASTTTLGQFCMHCSHRYCLSHHLPEIHGCGEKARAHA

C41D11_C.e.   LDQL----------------DCSSN-----------------------------------

YKL017C_S.c.  DDYL--------------------------------------------------------

 

 

IGHMBP2_H.s.  RQRISREGVLYAGSGTKNGSLDPAKRAQLQRRLDKKLSELSNQRTSRRKE--RGT

IGHMBP2_M.m.  RQRISREGVLYAGSGTKDRALDPAKRAQLQRRLDKKLGELSSQRTSRKKEKERGT

C41D11_C.e.   -------------------------------------------------------

YKL017C_S.c.  -------------------------------------------------------