S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein emb-4
WP:CE40670
CG31368 IBP160
Aquarius
IBP160
Aquarius
Database Links  
Cellular Function pre-mRNA splicing
Protein WP:CE43256
ZK1067.2
CG6204 Znfx1 ZNFX1
Database Links
Cellular Function

Group Alignment

IBP160_H.s.   ---MAAPAQPKKIVAP-----------TVSQINAEFVTQLACKYWAP-HIKKKSPFDIKV

IBP160_M.m.   ---MAAPAQPKKIVAP-----------TVSQINAEFVTQLACKYWAP-HIKKKSPFDIKV

CG31368_D.m.  -MKRRSQTRAEQAVPPAKTTKENSGSLTVSQLSSDVIWQLASQYWTPDTKADHLPYSAKI

emb-4_C.e.    MVTKRHQEAV----------------VTRGAIENDTISAVAAKFWAPFTAETHENFDAKL

ZNFX1_H.s.    MEERRPHLDARPRNSHTNHRGPVDGELPPRARNQANNPPANALRGGASHPGRHPRANNHP

ZNFX1_M.m.    MEDRRPHLEARPRNPPANHRGPMDGELPPRARNQTNNPA------ATNHAGRHLRASNHP

CG6204_D.m.   --------------------------------------------------------MSSS

ZK1067_C.e.   --------MVRNLAPP---------GLPPPGISISNSSPP-----GLSSVSPIPRADTRE

 

 

IBP160_H.s.   IEDIYEKEIVKSR-FAIRKIMLLEFSQYLENYLWMNYSPEVSSKAYLMSICCMVNE-KFR

IBP160_M.m.   IEEIYEKEIVKSR-FAIRKIMLLEFSQYLENYLWMNYSPEVSSKAYLMSICCMVNE-KFR

CG31368_D.m.  IERIYNEEIGDGGGHSARRINMLEFSQYLEQYLWPHYQRETATHAHLMSIVIMANE-KFR

emb-4_C.e.    IDTIYDNEMLKTS-FNSRKIMMLEFSQYLEAYLWPNYVPEKASKAWNMSIVVMINE-KFR

ZNFX1_H.s.    AAYWQREERFRAMGRNPHQGRRNQEGHASDEARDQRHDQENDTRWRNGNQDCRNRRPPWS

ZNFX1_M.m.    APFRQREERFRAMGRNPHQGRRNQEGHTSDEARDQR-QSQNDTRRRNDDQEGRSHRPPWS

CG6204_D.m.   DDDWFDQDENKLL-QGLEKSLKSLELQKNEEY-----------------IECPPSE-R--

ZK1067_C.e.   SRYSTPQPPGLSIPAPPGISLPTPPGISLQNHQNDQFEQAHSTISRMSENSSSSRR-RFR

 

 

IBP160_H.s.   -ENVPAWEIFKKKPDHFPFFFKH----ILKA------ALAETDGEFSLH-----------

IBP160_M.m.   -ENVPAWETFKKKPDHFPFFFKC----ILKA------ALAETDGEFSLH-----------

CG31368_D.m.  -ERVEVWTVFEKLPDQYPAFFRH----VLES-----CLPSKKAKEASSTLR---------

emb-4_C.e.    ERNLDSWNCFTKKSEHFPHFFKS----ILQL------SLQEEGLASS-------------

ZNFX1_H.s.    NDNFQQWRTPHQKPTEQPQQAKKLGYKFLES------LLQKDPSEVVITL----------

ZNFX1_M.m.    SDTFQQWHTPPQKPGEQPQQTKRLGYKFLES------LLQKEPSEVAITL----------

CG6204_D.m.   -------KCPPSEVGEYVMQHTR----F---------SLTELTNALKMP-----------

ZK1067_C.e.   DEEVQEEEGDHILSSEDVHAARN----VCETKILVRGVPQKNDSELSKLINGSKLYVRFE

 

 

IBP160_H.s.   ------EQTVLLLFLDHCFNSLEVDLIRSQVQQLISLPMWMGLQLARLELELKKTPKLRK

IBP160_M.m.   ------EQTLLLLFLDHCFNSLEVDLIRSQVQQLISLPMWMGLQPARLELELKKTPKLRK

CG31368_D.m.  ------ERTALLMFINHCFNSMEIELCREQAKRLVSLSMWHCLQPRRREQELREVPEWRK

emb-4_C.e.    ------EHCALLTFLVNAFGSVETPIVHKETRKLVSIEIWAGLLDSQREDLFKKQKKLKK

ZNFX1_H.s.    ------ATSLGL-----------KELLSHSSMKSNFLELICQVLRKACSSKMDRQSVLHV

ZNFX1_M.m.    ------ATSLGL-----------KELLSHSSMKPSFLQLICQVLRKACSSRIDRQSILHV

CG6204_D.m.   ------AIDMFLYFLSDKRDLFENQVLATDNVK--RVGLFVDVLWSLCELEL--------

ZK1067_C.e.   RPFVKLAHNLELLYVVNYAISSRKSIVRDHSKAIIRGLFEKDFLLKLKSKFLESSFDNDT

 

 

IBP160_H.s.   FWNLIKKNDEKMDPEAREQAYQERRFLSQLIQKFISVLKSVP-----------LSEPVTM

IBP160_M.m.   FWNLIKKNDEKMDPEAREQAYQERRFLSRLIQKFISVLKSIP-----------LSEPVTM

CG31368_D.m.  YWKRLLKKEKDSKP----EVLWERHFMQNLIIDFLHILESIP-----------AEGEVPR

emb-4_C.e.    IWENVR---QKMTAAAADNNEFERTYLWNLIEKFKRVLNSLEPNEAQESEEGEVRDPI--

ZNFX1_H.s.    L-----------------GILKNSKFLKVCLPAYVV---------------GMITEPIPD

ZNFX1_M.m.    L-----------------GILNNSKFLRVCLPAYVV---------------GMITEPSPD

CG6204_D.m.   -----------------------GGFDEVFLSAF--------------------------

ZK1067_C.e.   WTPEGTELLFEIFHLFFTTARYKGGFM-LTLPRFAPSWHDFSMAFDIADMDGLEEAGVGD

 

 

IBP160_H.s.   DKVHYCERFIELMIDLE---------ALLPTRRWFNTILDDSHLLVHCYLSNLVRREEDG

IBP160_M.m.   DKVHYCERFIELMIDLE---------ALLPTRRWFNTILDDSHLLVHCYLSSLVHREEDG

CG31368_D.m.  NVVHYCERFLEFIIDLE---------ALLPTRRFFNTVLDDCHLIVRALLSPLVRREE-G

emb-4_C.e.    DSIKYCERFIELLIDLE---------SILQTRRFFNSVLHSSHILTHCLLSSLISTDA-G

ZNFX1_H.s.    IRNQYPEHISNIISLLQ---------DLVSV--FPASSVQETSMLVSLLPTSLNALRASG

ZNFX1_M.m.    IRNQYPEHISNIISLLQ---------DLVSV--FPASSMQETSMLISLLPTSLNALRASG

CG6204_D.m.   ------SRQTALLDKIK---------NLLQAKAAVAKCDAESALILSHSKWMLLRAHKHG

ZK1067_C.e.   DELRNLRRLIGYIETWIKRAERERNPSPLALRSYSVYEKAGSSDSGRQVLSESRGAGSSN

 

 

IBP160_H.s.   HLFSQLLDML------KFYTGFEINDQTGNALTENEMTTIHYDRITSLQRAAFAHFPELY

IBP160_M.m.   HLFSQLLDML------KFYTGFEINDQTGNALTENEMTTIHYDRITSLQRAAFAHFPELY

CG31368_D.m.  KLFGQLLDML------KFYTRFEINDVTGSSLTDHDMTQLHYKKITSLQRAVFAKFPSL-

emb-4_C.e.    SLFFQLVQLL------KFYARFEIDDLSGRQLTHKEVSEQHYQSVTRLQKAAFRLFNETM

ZNFX1_H.s.    V----------------------------------DIEEETEKNLEKVQ-----------

ZNFX1_M.m.    V----------------------------------DIEEETEKNLEKVQ-----------

CG6204_D.m.   LLSHQGYELV-----------------------------ELYKKLAPSFKSDMID-----

ZK1067_C.e.   VYGHDEVDFVDHRRRDEFGHRDNYRTENRRHKSPDNFGEVH-RRLDEQQQQRHEDESSRY

 

 

IBP160_H.s.   -DFALSNVAEVDTRE--------SLVKFFGPLSSN--TL---------------HQVASY

IBP160_M.m.   -DFALSNVAEVDARD--------SLVKFFGPLSSN--TL---------------HQVASY

CG31368_D.m.  RVFALSNVATVDNRE--------SLEQHFGGLDGK--GL---------------LQIATF

emb-4_C.e.    KEFYVLNVSGVDTRR--------ALQKQFGDMNHA--EV---------YRFAEYLHLVPA

ZNFX1_H.s.    -----------------------TIIEHLQEKRRE--GT---------------------

ZNFX1_M.m.    -----------------------AIIKYLQEKRRQ--GS---------------------

CG6204_D.m.   -----------------------GLEAFTGNFSHNVKGL---------------------

ZK1067_C.e.   RDDSRQSRRADDRRDQYQYNESTSMENHLGFHNGG--GTVSEHSRDDKFVSPQNCEEKRK

 

 

IBP160_H.s.   LCLLPTLPKNEDTTF--DKEFLLELLVSRHERRISQIQQLNQMPLYPTEKIIWDENIVPT

IBP160_M.m.   LCLLPTLPKNEDTTF--DKEFLLELLVSRHERRISQIQQLNQMPLYPTEKIIWDENIVPT

CG31368_D.m.  LNLVPEEVVSPLDWHRVDEQFLRELLITRHERRCSQLEALNEMPLYPTEQIIWDENVVPS

emb-4_C.e.    FGEDPNHQTSLLHLY--PHQHLVETITLHCERRPNQLTQLNEKPLFPTEKVIWDENIIPY

ZNFX1_H.s.    --------------------LRVDTYTLVQPEAEDHVESYRTMPIYPT----YNEVHLDE

ZNFX1_M.m.    --------------------LRVDTYTLVQAEAEGEVESYRAMPIYPT----YNEVHLDE

CG6204_D.m.   --------------------------------------------IYPT----L-ETLLGK

ZK1067_C.e.   YCEEDTDAKPQQPYR--FEEIKFEPIWVKCEKS-EPPEDFKTLPSVPV----LSEYVNPV

 

 

IBP160_H.s.   EYYSGEGCLALPKLNLQ---FLTLHDYLLRNFNLFRLESTYEIRQDIEDSVSRMKPWQSE

IBP160_M.m.   EYYSGEGCLALPKLNLQ---FLTLHDYLLRNFNLFRLESTYEIRQDIEDSVSRMKPWQSE

CG31368_D.m.  EYYSGDSCLALPKLNLQ---FLTLHDYLLRNFNLFRLESTYEIRQDIEDAVSRMLPWKSE

emb-4_C.e.    ENYTGDGVLALDKLNLQ---FLTLHDYLLRNFNLFQLESTYEIRQDLEDVLFRMKPFQHE

ZNFX1_H.s.    RPF-----LRPNIISGK---YDSTAIYLDTHFRLLREDFVRPLREGILELLQSFEDQGLR

ZNFX1_M.m.    KPF-----LRPNIISGK---YESTAVYLDTHFRLLREDFVRPLREGILKLLQSFEDQCLR

CG6204_D.m.   DAT-----KAPNEEEDEGLVSDKVVKYVNALRNLLREDFLAPLVEFVQQLRSGTDVDELK

ZK1067_C.e.   EPY-----LRRIQDDGK---YKSVHHYLDVQFRLLKEDLVSPLRDGIDLYKKNGTCKGRR

 

 

IBP160_H.s.   YGG-VVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADVTINLNVR-DHIKDEWEGL

IBP160_M.m.   YGG-VVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADVTINLNVR-DHIKDEWEGL

CG31368_D.m.  DGD-VVFGGWARMALPIASFAVVEVAKPHLGEKKPSRVRADVGVTLSVR-REIKAEWENL

emb-4_C.e.    SRNETVFSGWARMALQIDHFQISEVAKPLVGEKSPAVVRGVVTVNIGRR-QDIRQEWENL

ZNFX1_H.s.    KRK-FD-----DIRI----YFDTRIITPMCSSSG-----IVYKVQFDTK-PLKFVRWQNS

ZNFX1_M.m.    KRK-FD-----DIRI----YFDARIITPMCSASG-----IVYKVQFDTK-PLKLVRWQNS

CG6204_D.m.   QQG-LL---WSDVHL---------TLNPQFANAQRHSL-VFLKVQFTKESKNAYKTW--L

ZK1067_C.e.   IEGAPC----SDISI----FNVEKVDGKQVTERDGYEMRIIWPAQYD-----ILKLLDND

 

 

IBP160_H.s.   RKHDVCFLI-TVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIED--GPE

IBP160_M.m.   RKHDVCFLI-TVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGMLDDKGRVIED--GPE

CG31368_D.m.  RKHDVCFLI-TVKPTQPYGTKYKHREPFVPQVGLVSVRGCEVEGMLDANGRVIED--GPE

emb-4_C.e.    RKHDVCFLVACRSRKSASGLKFDVRRPFSEQIEVLSVRGCDVEGMLDQDGHLLEEFTAWE

ZNFX1_H.s.    KRLLYGSLV-CMSKDN-----------F-ETFLFATVSNREQEDLCRGIVQL--------

ZNFX1_M.m.    KRLLYGSLV-CMSKDN-----------F-ETFLFATVSNREHEDLCQGIVQL--------

CG6204_D.m.   NSIKSGTLL-CLTTSL-----------AFDDLILASVGYTEPEKLKEDCLSV--------

ZK1067_C.e.   REMKELGLV-MLSCDR-----------FKEDFHLGHIQSSYL--MRNGSLHF--------

 

 

IBP160_H.s.   PRPNLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYETFNIIMRRKPKENNFKAVLETI

IBP160_M.m.   PRPNLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYDTFNVIMRRKPKENNFKAVLETI

CG31368_D.m.  PRPQLQGENRCYRVWLDSNQYRLDMDD-LQEGADDVYESFNILMRRKPKENNFKAVLETI

emb-4_C.e.    KKAKIPGDLRKFRLLLDPNQYRIDME---QGTKDDIYDTFNLIVRRDSKTNNFKAVLQTI

ZNFX1_H.s.    ---CFNEQSQQLLAEVQPS------------------DSF-LMVETTAYFEAYRHVLEGL

ZNFX1_M.m.    ---CFNEQSQQLLADVQPS------------------DSF-LMVETTAYFEAYRHVLEGL

CG6204_D.m.   ---QIVKQYNIGNAYNRPL----------------------IMFQAPVFFEPYLRVHNYL

ZK1067_C.e.   ---AVHEETSPFK----PN------------------TTY-QMAQGTSYLPCYKHVLENL

 

 

IBP160_H.s.   RNLMNTDCVVPDWLHDIILGYGDPSSAHYS-------KMPNQIATLDFNDTFLSIEHLKA

IBP160_M.m.   RNLMNTDCVVPDWLHDIILGYGDPSSAHYS-------KMPNQIATLDFNDTFLSIEHLKA

CG31368_D.m.  RHLMNTECVVPPWLHDILLGYGDPGAAHYS-------NMPNQERSLEFNDTFMDYNHLEA

emb-4_C.e.    RDLLNTECVVPDWLTDVILGYGEPDSAHYS-------KLSSAVPELDFNDTFLSFAHVKE

ZNFX1_H.s.    QEVQE-EDV--PFQRNIVECNSHVKEPRYL--------------LMGGRYDFTPL-----

ZNFX1_M.m.    QEVQE-EDV--PFQRNIVQCDSYVRNPRYL--------------LMGGRYDFTPL-----

CG6204_D.m.   STCST-EKF--PMGRYIVDGQMEIPPPAYM------------------------------

ZK1067_C.e.   KRISSFKPL--PFERYLVHGSKIIFRPNFQQAEKSEYQISEEKKLMKTYNELRSLAACAR

 

 

IBP160_H.s.   SFPGHNVKVTVE-DPALQIPPFRITFPVRSGKGKKRKDADVEDEDTEEAKTLIVEPHVIP

IBP160_M.m.   SFPGHNVKVTVS-DPALQIPPFRITFPVRSGKGKKRKDADGEEDDTEEAKTLIVEPHVIP

CG31368_D.m.  SFPQYNLKCEV--PVENRQPPFRLIFEDVPIQKESDGEDPEEKPEEKLTKSILVQPYKYE

emb-4_C.e.    SFPGYKIELADGFDEKEAVPPFKLEF-----KELERRQDVEIKPGE--LRTILVTPLTRK

ZNFX1_H.s.    ----------IE-NPSATGEFLRNVE-------------GLRHPRINVLDP---------

ZNFX1_M.m.    ----------ME-NPSAMRKSLRGAE-------------ALRHPRINVFDF---------

CG6204_D.m.   -------------KPGVKLSFNMKPF-------------TLDKLPEDLH-----------

ZK1067_C.e.   YTKGKPIPRGVD-DDDEDYEFSKSRE-----LSKEDIDLEYRQLQEPIFRPLVGVDIKDS

 

 

IBP160_H.s.   NRGPYPYNQPKRNTIQ-------FTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIIS

IBP160_M.m.   NRGPYPYNQPKRNTIQ-------FTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIIS

CG31368_D.m.  ARGPYPSDKPKQNSIR-------FTPTQVEAIRAGMQPGLTLVVGPPGTGKTDVAVQIIS

emb-4_C.e.    KVTPYSYD-PRKNQVK-------FTPSQVEAIKSGMQPGLTMVVGPPGTGKTDVAVQIIS

ZNFX1_H.s.    ------GQWPSKEALK-------LDDSQMEALQFALTRELAIIQGPPGTGKTYVGLKIVQ

ZNFX1_M.m.    ------GQWPSKEALK-------LDDSQMEALQFALTKELAIIQGPPGTGKTYVGLKIVQ

CG6204_D.m.   -----------------------LNESQKTAFKEALCREFSIIQGPPGTGKTHLSVQLVN

ZK1067_C.e.   NLIQINKKWYNVSRLLDEFHPDYMDESQRLAFCNTFKYELSLIQGPPGTGKTHIGVQIVK

 

 

IBP160_H.s.   NIYHN---FPEQ----RTLIVTHSNQALNQLFEKIMAL---------DIDERHLLRLGHG

IBP160_M.m.   NIYHN---FPEQ----RTLIVTHSNQALNQLFEKIMAL---------DIDERHLLRLGHG

CG31368_D.m.  NIYHN---HPNQ----RTLIVTHSNQALNQLFEKIMAL---------DIDERHLLRLGHG

emb-4_C.e.    NIYHN---WPNQ----RTLIVTHSNQALNQLFEKIIAL---------DVDERHLLRMGHG

ZNFX1_H.s.    ALLTNESVWQISLQKFPILVVCYTNHALDQFLEGIY-----------NCQKTSIVRVGGR

ZNFX1_M.m.    ALLTNKSVWQINTQTFPILVVCYTNHALDQFLEGIY-----------GCQKTSIVRVGGR

CG6204_D.m.   SLIQNAKALGTG----PIIVLTYTNNSLDKFLVKI------------SRYTQEILRFGNQ

ZK1067_C.e.   TILQNRSYWKITE---PILVVCFTNSGLDNLLERIYQMIENDEELSKDNGRPKIIRFGSK

 

 

IBP160_H.s.   EEE-------LETEKDFSRYGR-VNYVLARRIELLEEVKRLQKSLGVPGDASYTCETAG-

IBP160_M.m.   EEE-------LETEKDFSRYGR-VNYVLARRIELLEEVKRLQKSLGVPGDASYTCETAG-

CG31368_D.m.  EEA-------LETEKDYSRYGR-VNYVLAKRMDLLSQVQKLQEALGVSGDNAYTCETAG-

emb-4_C.e.    EEA-------LETEKDFSRYGR-VNYVLKERLQLLNCVEKLAKALKIVGDVAYTCENAG-

ZNFX1_H.s.    SNSEILKQFTLRELRNKREFRRNLPMHLRRAYMSIMTQMKESEQELHEGAKTLECTMRGV

ZNFX1_M.m.    SNSEILKQFTLRELRNKREFRRTLPMHLRRAYMSIVTEMKESEQKLQEGAQTLECTMHGV

CG6204_D.m.   SRDPQISKFNL-STTIKPEL---VPPRLKRIWWLVNCEYKEKFRNL--------------

ZK1067_C.e.   CDSNYLKRQNVMRQDVYEQYKSKVSDGAQKKMSKAGAARRHKADNLAISSYTLFCSRNKL

 

 

IBP160_H.s.   ----YFFLYQVMSRWEEYISKVK-------------------------NKGST----LPD

IBP160_M.m.   ----YFFLYQVMSRWEEYMSRVK-------------------------NSGTACPDAAPD

CG31368_D.m.  ----YFYLYNVMARWEKFQSQI------------------------SVHKGEA--DAEKL

emb-4_C.e.    ----YFFRFSVCRVWEEFLAKV------------------------T-SKGCN----KLA

ZNFX1_H.s.    LREQYLQKYISPQHWESLMNGPVQDSEWICFQHWKHSMMLEWL---GLGVGSFTQSVSPA

ZNFX1_M.m.    LREQHLEKYISAQHWESLMSGPVQDADWVCVQPSKHSMILEWL---GLGVGSFTQSASPA

CG6204_D.m.   -------------------QGLY-------------------------------------

ZK1067_C.e.   LSYEMLSRVMDPNHQMEIQQFTYDHVDTKGIPLSPDEAIGCWLLERDFGKATKSQTKKAK

 

 

IBP160_H.s.   VTEVSTFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCFRH--------------------

IBP160_M.m.   AAQVATFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCFRH--------------------

CG31368_D.m.  RAEFEKEFPFGKFFADAPQPLFKGANYDELMDIACSNFRY--------------------

emb-4_C.e.    EGIISEIFPFTGFFKDIPD-LFSGNN-SADLKVAHSCWRH--------------------

ZNFX1_H.s.    GPENTAQAEGDEEEEGEEESSLIEIAEEADLIQADRVIEEEEVVRPQRRKKEESGADQEL

ZNFX1_M.m.    GPENTAQAEGEEEEEGEEEGSLIEIAEEADLIQADRVIEEEEVVRPRRRKKEENGTDQEL

CG6204_D.m.   -------ANFDGSEESYQ-----------DTLAAQEKLNQ--------------------

ZK1067_C.e.   KPKFQG-AQLDSEDENKDYFTVEDSDDEEDELDDEKLLDK----LFEKMNLECSGAD---

 

 

IBP160_H.s.   ------------------------------------------------------------

IBP160_M.m.   ------------------------------------------------------------

CG31368_D.m.  ------------------------------------------------------------

emb-4_C.e.    ------------------------------------------------------------

ZNFX1_H.s.    AKMLLAMRLDHCGTGTAAGQEQATGEWQTQRNQKKK----MKKR----------------

ZNFX1_M.m.    AKMLLAMRLDQEVPGTTAGPEQATEEWETQRGQKKK----MKRR----------------

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   --ILSAVHASHADEYYTKGP------WEIVQDKRPSVVVLMEKKTKPCNAKFTVDEQINN

 

 

IBP160_H.s.   -------------------------------------------------IKKIFTQLEEF

IBP160_M.m.   -------------------------------------------------IKKIFTQLEEF

CG31368_D.m.  -------------------------------------------------ISDIFNELEEF

emb-4_C.e.    -------------------------------------------------IEQIFEKLDEF

ZNFX1_H.s.    ----VKDELRKLNTMTAAEANEIEDVWQLDLSSRWQLYRLWLQLYQADTRRKILSYERQY

ZNFX1_M.m.    ----VKVELRKLNTMTKAEANGIQDVWQLDLSSRWQLYRLWLQMYQADTRRRILSYERQY

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   LVSEIKDMILSSQPVPKKDLNDIKYIFSLARLKRWSLYITWCDALRSIVTENLPRQIREY

 

 

IBP160_H.s.   R-ASELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRHDLVKLGFKYDNILMEEAAQILEI

IBP160_M.m.   R-ASELLRSGLDRSKYLLVKEAKIIAMTCTHAALKRHDLVKLGFKYDNILMEEAAQILEI

CG31368_D.m.  R-AFELLRTGLDRSKYLLVKEAKIIAMTCTHAALKRKELVNLGFRYDNILMEESAQILEI

emb-4_C.e.    R-AFELLRNGRDRTEYLLVKEAKIIAMTCTHAALRRNELVKLGFRYDNIVMEEAAQILEV

ZNFX1_H.s.    RTSAERMAELRLQEDLHILKDAQVVGMTTTGAAKYRQILQKVEPRI--VIVEEAAEVLEA

ZNFX1_M.m.    RTWAERMAELRLQEDLHILKDAEVVGMTTTGAAKYRQILQQVEPRI--VIVEEAAEVLEA

CG6204_D.m.   --VAERIETLRMVFQFFLAREKDLLAMTTTCAARHNFLFRLLQSKC--VLFEEAAEIQEA

ZK1067_C.e.   REACENFKNAQNRVDAEIMRMTMIIGATTTGCSRLRPTLEKVGPRI--LIVEEAAEVLEA

 

 

IBP160_H.s.   ETFIPLLLQNPQDGFSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLFTRFVRVGVPT

IBP160_M.m.   ETFIPLLLQNPQDGFSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLFTRFVRVGVPT

CG31368_D.m.  ETFIPLLLQNPLDGLNRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLFTRLVRLGVPT

emb-4_C.e.    ETFIPLLLQNPQDGHNRLKRWIMIGDHHQLPPVVQNQAFQKYSNMEQSLFARLVRLSVPN

ZNFX1_H.s.    HTIATLS--------KACQHLILIGDHQQLRPSANVYDLAKNFNLEVSLFERLVKVNIPF

ZNFX1_M.m.    HTIATLS--------KACQHLILIGDHQQLRPSANVYDLAKNFNLEVSLFERLVKVNIPF

CG6204_D.m.   HIVACLT--------PHTEHVILVGDHKQLQPFSGSRKVP-----QISLFERLIVAGLPF

ZK1067_C.e.   HIISAMI--------STVEHVVMIGDHKQLRPNPAVHELGVAYGLRISMFERLVERGLPF

 

 

IBP160_H.s.   VDLDAQGRARASLCNLYN-WR-YKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGV

IBP160_M.m.   VDLDAQGRARASLCNLYN-WR-YKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGV

CG31368_D.m.  VDLDGQGRARASICSLYK-WR-YKKLEDLQHIFERDEYKQANPGFVHDYQLINVEDFKGV

emb-4_C.e.    VQLDRQGRARAQIAELYQ-WR-YNGLGNLPHVDGLPQFQNANAGFAFPFQFIDIPDFNGH

ZNFX1_H.s.    VRLNYQHRMCPEIARLLT-PHIYQDLENHPSVLKYEKIKGVSSNLFF-------VEHNFP

ZNFX1_M.m.    VRLNYQHRMRPEIARLLT-PHIYQDLENHPSVLKYEQIKGVSSNLFF-------VEHNFP

CG6204_D.m.   SRLNLQYRMRSCISELLV-PSIYDELLCSESVKEYEDIRLMSKNLYF-------VQHNQP

ZK1067_C.e.   SQLRQQHRMNLTISDKIVKLSFYDNVTDAENVGLYPDVQGMATNLFF-------WSHTSM

 

 

IBP160_H.s.   GESEPNPYFYQNLGEAEYVVALFMYMCLL-GYPADKISILTTYNGQKHLIRDIINRRCGN

IBP160_M.m.   GESEPNPYFYQNLGEAEYVVALFMYMCLL-GYPADKISILTTYNGQKHLIRDIINRRCGN

CG31368_D.m.  GESEPNPYFYQNLAEAEYIVAVYMYMRLL-GYPAAKISILTTYNGQKHLIRDVINARCGN

emb-4_C.e.    GETQPSPHFYQNLGEAEYACALYTYMRIL-GYPAEKISILTTYNGQAQLIRDVFQRRCDT

ZNFX1_H.s.    EQEIQEGKSHQNQHEAHFVVELCKYFLCQ-EYLPSQITILTTYTGQLFCLRKLMPAKTFA

ZNFX1_M.m.    EQEIQEGKSHQNQHEAHFVVELCQYLLCQ-EYLPSQITILTTYTGQLFCLRKLMPVKTFA

CG6204_D.m.   EHCMSD-MSIGNLYEAGVLAKLTEFLIQKAQYKHSDIVILSPYNGQIECIKNALPQNYRS

ZK1067_C.e.   EES-PDEVSWLNKHEISMTVALVKHLLKQ-NYTTNDIVVLATYSAQKNLMYREYANVFGS

 

 

IBP160_H.s.   NPLIGRPNKVTTVDRFQGQQNDYILLSLVRTRA-------VGHLRDVRRLVVAMSRARLG

IBP160_M.m.   NPLIGRPNKVTTVDRFQGQQNDYILLSLVRTRA-------VGHLRDVRRLVVAMSRARLG

CG31368_D.m.  NPLIGWPHKITTVDKYQGQQNDYILISLVRTKA-------VGHLRDVRRLVVAMSRARLG

emb-4_C.e.    NPLIGMPAKVSTVDKYQGQQNDFIILSLVKTRN-------IGHIRDVRRLVVALSRARLG

ZNFX1_H.s.    G------VRVHVVDKYQGEENDIILLSLVRSNQEGK----VGFLQISNRICVALSRAKKG

ZNFX1_M.m.    G------IKVHVVDKYQGEENDIILLSLVRSNQEGK----VGFLQIPNRICVALSRAKKG

CG6204_D.m.   T------VQVASVDSFQGLEANIVLLSLVRSNISGR----IGFLRQANRVCVALSRARWA

ZK1067_C.e.   TPDSNV-IPVETVDSFQGKERKIVIVSLVRSHRGGRENTGIGFLAVANRICVALTRAQHG

 

 

IBP160_H.s.   LYIFAR-VSLFQNCF--ELTPAFSQLTARPLHLHIIPTEPFPTTRKNG-ERPSHEV----

IBP160_M.m.   LYIFAR-VSLFQNCF--ELTPAFSQLTARPLHLHIIPTEPFPTSRKNG-ERPPHEV----

CG31368_D.m.  LYVFGR-VSLFKNCL--ELQQTFK---LRPLKLSLVPEDKFPTDRLASAAVASQDI----

emb-4_C.e.    LYVLGR-SKVFMDCL--ELTPAMRIFAKYPRKLVILPFEAHPTIRKWNERSKDGEP----

ZNFX1_H.s.    MYCIGN-MQMLAKVP--LWSKIIHTLRENNQIGPMLRLCCQNHPETHTLVSKASDF-QKV

ZNFX1_M.m.    MYCIGN-MQMLAKVP--LWSRIIHTLRENNQIGPSLRLCCQNHPETHTLVSKASDF-QKV

CG6204_D.m.   LYIVGN-VTILKDTFPKIWNPIVKRLKENNAIGEAFPTITST------------------

ZK1067_C.e.   MYIIGNGAYIMNNSE--LWNKIVNNLRRSNLIEYNLPLKCVAHGNIVT-VKDPQDFATKS

 

 

IBP160_H.s.   ------------------------------------------------------------

IBP160_M.m.   ------------------------------------------------------------

CG31368_D.m.  ------------------------------------------------------------

emb-4_C.e.    ------------------------------------------------------------

ZNFX1_H.s.    PEGGCSLPCEFRLGCGHVCTRACHPYDSSHKEFQCMKPCQKVICQE--GHRCPLVCFQEC

ZNFX1_M.m.    PEGGCSRPCEFRLACGHVCTRACHPYDSSHKEFQCMKPCQKVLCQD--GHRCPNVCFQEC

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   PEGGCMQKCDTKKFCGHVCERLCHPNMEEEHLQRCLYNCDKKCSNPQFQHRCKKACYEEC

 

 

IBP160_H.s.   ------------------------------------------------------------

IBP160_M.m.   ------------------------------------------------------------

CG31368_D.m.  ------------------------------------------------------------

emb-4_C.e.    ------------------------------------------------------------

ZNFX1_H.s.    QPCQVKVPKTIPRCGHEQMVPCSVPESDFCCQEPCSKSLRCGHRCSHPCGEDC--VQLCS

ZNFX1_M.m.    QPCQVKVPKIILKCGHKQMVPCSMSESEFCCQEPCSKILRCGHRCSHLCGEDC--VRLCS

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   GSC-LYLVEVTLDCGHRITTPCSRINSS-KCDQSCTKKLLCGHACAAKCGEECTLVSECS

 

 

IBP160_H.s.   ------------------------------------------------------------

IBP160_M.m.   ------------------------------------------------------------

CG31368_D.m.  ------------------------------------------------------------

emb-4_C.e.    ------------------------------------------------------------

ZNFX1_H.s.    EMVTIKLKCGHSQPVKCGHV----------------------------------------

ZNFX1_M.m.    ERVTVELKCGHSQLVKCGNV----------------------------------------

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   QLVGMPLSCGHIKQLTCSKISANEIDLTCDQRCEKTMLACPHKCAEICGQPCTVECMEVV

 

 

IBP160_H.s.   ------------------------------------------------------------

IBP160_M.m.   ------------------------------------------------------------

CG31368_D.m.  ------------------------------------------------------------

emb-4_C.e.    ------------------------------------------------------------

ZNFX1_H.s.    ---------EGLLYGGL-------------------LVK---------------CTTKCG

ZNFX1_M.m.    ---------EDIKY-GL-------------------PVK---------------CTTKCD

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   NVTLGCSHSQDVVCSSFMPGMTDHIECLTKVPKTLSPCKHTELVLCKQAPSTKLCTRRCT

 

 

IBP160_H.s.   ------------------------------------------QIIKNMPQMANFVYNMYM

IBP160_M.m.   ------------------------------------------QVIKNMPQMANFVYNMYM

CG31368_D.m.  ------------------------------------------KTVENMSEMAQFVYERYM

emb-4_C.e.    ------------------------------------------MEIQDTLHMTHFVHEFYM

ZNFX1_H.s.    TILD-CGHPCPGSCHSCFEGRFHERCQQPCKRLLICSHKCQEPCIGECPPCQRTCQNRCV

ZNFX1_M.m.    TTLD-CGHPCPGSCHSCFEGRFHERCQQPCKRLLICSHKCQEPCTGECPPCQRTCQNRCV

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   SYLEKCGHTCENDCGICFTTKTH-ICQNMCQKVLNCGHTCSAKCGESCPPCKAFCTNKCE

 

 

IBP160_H.s.   HL----------------------------------------------------------

IBP160_M.m.   HL----------------------------------------------------------

CG31368_D.m.  AK----------------------------------------------------------

emb-4_C.e.    SN----------------------------------------------------------

ZNFX1_H.s.    HSQC-------KKKCGELCSPCVEPCVWRCQHYQCTKLCSEPCNRPPCYVPCTKLLVCGH

ZNFX1_M.m.    HSQC-------KKKCGELCSPCVEPCVWRCQHYQCTKLCSEPCNRPPCYVPCTKLLACGH

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   HQSCGAGERGFGRDCSKLCALCVNNCSNKCAHRSCTLKCFEECNVKPCTEPCTDKLKCGH

 

 

IBP160_H.s.   ------------------------------------------------------------

IBP160_M.m.   ------------------------------------------------------------

CG31368_D.m.  ------------------------------------------------------------

emb-4_C.e.    ------------------------------------------------------------

ZNFX1_H.s.    PCIGLCGEPCPKKCRICHMDEVTQIFFGFEDEPDA-RFVQLEDCSHIFEVQALDRYMNEQ

ZNFX1_M.m.    PCIGLCGEPCPKKCRVCQPDEVTQIFFGFEDEPDA-RFVQLEDCSHIFEVQALDRFMNEQ

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   ACLGICGEQCPKICGTCERNKYIECVSGTSSTSRVHRLIMIPKCYHVFPVEVLDDHVKKQ

 

 

IBP160_H.s.   -----------IQTTHHYHQTLLQLPPAMVEEGEEVQNQETELETEEEAMTVQADIIPSP

IBP160_M.m.   -----------IQTTHHYHQTFLQLPPAMVEEGEEGQSQETEMEAEEETVSAQGNLTPSP

CG31368_D.m.  -----------ME----------ELKGTLPSEEELEAMRNQLLQEDEESVPEASE---EP

emb-4_C.e.    -----------LPAMRD------AYEQAMNEYMESQRLLNPPIDETQMDVETEHEKKHRE

ZNFX1_H.s.    KDDEVAIRLKVCPICQVPIRKNLRYGTSIKQRLEEIEIIKEKIQGSAGEIATSQERLKAL

ZNFX1_M.m.    KDDEVAIKLKVCPICQVPIRKNLRYGTSIKQRLEEIEIVKEKIQGSAGEISTSQEQLKAL

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   KEANEKLK---CPKCSAFIVGVLRYARYTKKYY-----LNENMRKLESNIRNIHQ---ST

 

 

IBP160_H.s.   TDTSC-------------------------------------------------------

IBP160_M.m.   ADASL-------------------------------------------------------

CG31368_D.m.  PEKRA-------------------------------------------------------

emb-4_C.e.    AMERK-------------------------------------------------------

ZNFX1_H.s.    LERKSLLHQLLPEDFLMLKEKLAQ-KNLSVKDLGLVENYIS-FYDHLASLWDSLKKMHVL

ZNFX1_M.m.    LKSKTLFHQLRPEEFLILQEKLAQ-KNLSVKDLGLVENSIR-FYDHLANLEGSLEKVHCG

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   LEGRV---------FQAVQDSIGEIRNVTTNLTNASEDILRNFHQKILDIRTSAETFKGK

 

 

IBP160_H.s.   --------------------------------------------------------RQET

IBP160_M.m.   --------------------------------------------------------SQET

CG31368_D.m.  --------------------------------------------------------AKEE

emb-4_C.e.    --------------------------------------------------------KKQE

ZNFX1_H.s.    EEKRVR--TRLEQVHEWLAKKRL-SFTSQELSDLRSEIQRLTYLVNLLTRYKIAEKKVKD

ZNFX1_M.m.    EQQSVR--TRLEQVHEWLAKKRL-SFSSQELSDLQSEIQRLTYLVNLLMRCKMAE-KVKG

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   PEHKFKFASLLQVANCCLAITRLLSVSSKFRVSRRKDIPPTFDLMSVRVLGDMPFPKLID

 

 

IBP160_H.s.   PAFQTDTTPSETGATSTPEAIPALSETTPTVVGAVSAPAEAN------------------

IBP160_M.m.   PAAQPDCS-SQTEDTSAPCDIATAAEPVSAAAEAA-------------------------

CG31368_D.m.  PLSKKKTT-----EAFKPTPILNEINVDDTEMGQREQIEEEATD----------------

emb-4_C.e.    MDDKKEADIH--------------FEDMDHEMQEPAATAAPAPG----------------

ZNFX1_H.s.    SIAVEVYSVQNILEK--TCKFTQEDEQLVQEKMEALKATLPCSGLGISEEERVQIVSAIG

ZNFX1_M.m.    SIAEEVSSIRNILEK--TSKFTQEDEQLVQKKMDALKTTLPCSGLGISDEERVQIVTAMG

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   ELNRVNIHLSNTYETFMPGAIIPKLKWLISRMTVLQQLTSMCHQLVLEKKD---------

 

 

IBP160_H.s.   -------------------------------------------------------TPQDA

IBP160_M.m.   -------------------------------------------------------TPQDA

CG31368_D.m.  -------------------------------------------------------QDKTQ

emb-4_C.e.    -------------------------------------------------------APAVE

ZNFX1_H.s.    YPRGHWFKCRNGHIYVIGDCGGAMERGTCPDCKEVIGGTNHTLERSN------QLASEMD

ZNFX1_M.m.    VPRGHWFKCPNGHIYVITECGGAMQRSTCPECQEVIGGENHTLERSN------HLASEMD

CG6204_D.m.   ------------------------------------------------------------

ZK1067_C.e.   ----------------IADSDAHAINDACLNMFRYNEQHNYALNIENFEAIVVKVAPKLL

 

 

IBP160_H.s.   TSAPEETK----------------

IBP160_M.m.   ESVPTETE----------------

CG31368_D.m.  ESAPAEES----------------

emb-4_C.e.    EPPPK-------------------

ZNFX1_H.s.    GAQHAAWSDTANNLMNFEEIQGMM

ZNFX1_M.m.    GAQHPAWSNTANNFMNFEEIHRMM

CG6204_D.m.   ------------------------

ZK1067_C.e.   EPTPKFWSWRRLQVPELYELVHFP