S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Prp22p
YER013W
mog-5
CG8241
DHX8 DHX8
HRH1
Database Links
Cellular Function pre-mRNA splicing pre-mRNA splicing

Group Alignment

Q14562|DHX8_HS       MAVAVAMAGALIGSEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN

A2A4P0|DHX8_MM       MAVAVAAAGVLMGSEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN

A1Z9L3|Prp22_DM      ------------------MDELQKLEYLSLVSKICTELDNHLGINDKDLAEFIIDLENKN

Q09530|MOG5_CE       ---------------------MDQLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQEN

P24384|PRP22_SC      ------------------------------MSDISKLIGAIVGSDDPVIIEFVLNIINKS

                                                   :*.: . :   .*  :  : **:: : ::.

 

Q14562|DHX8_HS       TTFDTFKASLVKN--GAEFTDSLISNLLRLIQTMRPPAK----PSTSKDPVVK----PKT

A2A4P0|DHX8_MM       TTFDTFKASLVKN--GAEFTDSLISNLLRLIQTMRPPAK----PSTSKDPVVK----PKT

A1Z9L3|Prp22_DM      RTYDTFRKALLDN--GAEFPDSLVQNLQRIINLMRPSRP----GGASQEKTVG----DKK

Q09530|MOG5_CE       PTFDKLKKALDSQGLGDQFDDSLTATILRIVQSMTAVKKKNKKGGDSKEDIKDSHKITLI

P24384|PRP22_SC      GNLQEFIRNIQKLDAGISYEDS-----IKMYNAFLGKQE--------EEKVRN-------

                      . : :   : .   * .: **      :: : :             ::          

 

Q14562|DHX8_HS       E--KEKLKELFPVLCQPDNPSVRTMLDEDDVKVAVD------------------VLKELE

A2A4P0|DHX8_MM       E--KEKLRELFPVLCQPDNPSARTMLDEEDVKVAVD------------------VLKELE

A1Z9L3|Prp22_DM      EDKKSQLLKMFPGLALPNDTYSKKEESDDDEKVKAKPEKHSETHKKTDMSDVDAAMMELE

Q09530|MOG5_CE       SDAKEEIKARLPALAMAN-TAKEKEDNEDD------------------------LMAQLE

P24384|PRP22_SC      -------KVKSSPLSQKINQVLKDDVNLDD------------------------------

                                . *.       .   . :*                             

 

Q14562|DHX8_HS       ALMPSAAGQEKQRDAEHRDRTKKKKRSRSRDRNR------DRDRDRERNRDRD-------

A2A4P0|DHX8_MM       ALMPSAAGQEKQRDPEHRDRTKKKKRSRSRDRDR------DRDRDRDRDRDRDRDRDKDR

A1Z9L3|Prp22_DM      ALAPGEGATLVRPHKEVSSRDRHKRRSRDRDTKRRSRSREDRHSDRRRSRSRDKE-----

Q09530|MOG5_CE       KMEGRYESEKRLQKESDSKRNRSRSRSRSRDRKR----------RRSRSGDRD-------

P24384|PRP22_SC      ---------PVVTEFVLSILNKSKSITEFQEQLN-----------LMQSGLDN-------

                                  .       : :  :. ::  .             :.   :      

 

Q14562|DHX8_HS       -----------------HKRRHRSR-SRSRSRTRE-RNKVKSR-YRSRSRSQSPPKDRKD

A2A4P0|DHX8_MM       ERDRDRERDRERDRERDHKRRHRSR-SRSHSRTRE-RTKGKSR-YRSRSRSQSPFKDRKD

A1Z9L3|Prp22_DM      -----------------RRRRSRSRDNRRRSRSREDRDRDRDRRHKSSSSRDHHERRRRS

Q09530|MOG5_CE       -----------------RRRRSRSR-EDRRDRDRRDRDRDRDR-GRGDRRGDDRQRDRRD

P24384|PRP22_SC      ------------------ETIFKIYQIASPPVMKEEVSVLPST--KIPAKIEAKIEEEVQ

                                       .   :          :.      .   :     :   . . .

 

Q14562|DHX8_HS       RDKYGERN--LDRWRDKHVDRPPP-----EEPTIGDIYNGKVTSIMQFGCFVQLEGLRKR

A2A4P0|DHX8_MM       REKYGERN--LDRWRDKHVDRPPP-----EEPAIGDIYNGKVTSIMQFGCFVQLEGLRKR

A1Z9L3|Prp22_DM      RSRSTERRDRRDRSRDCSEKMPPPSAAMTDDPEAGKIYSGKIANIVPFGCFVQLFGLRKR

Q09530|MOG5_CE       RRDDGGAR----KS---------------EVAEIGKIYDGRVNSIQSFGAFITLEGFRQK

P24384|PRP22_SC      KIESLDPS-----------------------PVLHKVYEGKVRNITTFGCFVQIFGTRMK

                     :                              .   .:*.*:: .*  **.*: : * * :

 

Q14562|DHX8_HS       -WEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTG-TKTSLSMKDVDQETGEDLNP

A2A4P0|DHX8_MM       -WEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTG-TKTSLSMKDVDQETGEDLNP

A1Z9L3|Prp22_DM      -WEGLVHISQLRAEGRVTDVTEVVTRNQTVKVKVMSITG-QKVSLSMKEVDQDSGKDLNP

Q09530|MOG5_CE       -QEGLVHISQIRNE-RVQTVADVLKRGENVKVKVNKIEN-GKISLSMKEVDQNSGEDLNP

P24384|PRP22_SC      NCDGLVHISEMSDQ-RTLDPHDVVRQGQHIFVEVIKIQNNGKISLSMKNIDQHSGEIRKR

                       :******::  : *.    :*: :.: : *:* .: .  * *****::**.:*:  :

 

Q14562|DHX8_HS       NRRRNLVGETNEETSMRNPDRP-----THLSLVSAPEVEDDSLER---KRLTRISDPEKW

A2A4P0|DHX8_MM       NRRRNLVGETNEETSMRNPDRP-----THLSLVSAPEVEDDSLER---KRLTRISDPEKW

A1Z9L3|Prp22_DM      ---LSHAPEDDESLRDRNPDGPFSSSTSMLNLQGNGMEGDEHESR---KRVTRISSPERW

Q09530|MOG5_CE       --RETDLNPDAIGVRPRTPPAS---TSSWMNPEASGVGQGPSTSIGGGKARVRISTPERW

P24384|PRP22_SC      -------NTESVEDRGRSNDAH-----------TSRNMKNKIKRR-------ALTSPERW

                                     *.                     .             :: **:*

 

Q14562|DHX8_HS       EIKQMIAANVLSKEEFPDFDEETGILP------------------------KVDDEED-E

A2A4P0|DHX8_MM       EIKQMIAANVLSKEEFPDFDEETGILP------------------------KVDDEED-E

A1Z9L3|Prp22_DM      EIKQMISSGVLDRSEMPDFDEETGLLP------------------------KDEDDE--A

Q09530|MOG5_CE       ELRQMQGAGVLTATDMPDFDEEMGVLR------------------------NYDDESDGE

P24384|PRP22_SC      EIRQLIASGAASIDDYPELKDEIPINTSYLTAKRDDGSIVNGNTEKVDSKLEEQQRDETD

                     *::*: .:..    : *::.:*  :                          : :: .  

 

Q14562|DHX8_HS       DLEIELVEEE-PPFLRG-HTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELK-QA

A2A4P0|DHX8_MM       DLEIELVEEE-PPFLRG-HTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELK-QA

A1Z9L3|Prp22_DM      DIEIEIVEEE-PPFLSG-HGRALHDLSPVRIVKNPDGSLAQAAMMQSALSKERREQK-ML

Q09530|MOG5_CE       DIEIELVEDE-PDFLRG-YGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQA

P24384|PRP22_SC      EIDVELNTDDGPKFLKDQQVKGAKKYEMPKITKVPRGFMNRSAINGSNAIRDHREEKLRK

                     ::::*:  :: * ** .   :   . .  ::.* * * : ::*:  .   ::::* *  

 

Q14562|DHX8_HS       QREAEMDSIP-MGLNKHWVDPLPDAEGRQIAAN-MRGIGMMPNDIPEWKKHAFGGNKASY

A2A4P0|DHX8_MM       QREAEMDSIP-MGLNKHWVDPLPDAEGRQIAAN-MRGIGMMPNDIPEWKKHAFGGNKASY

A1Z9L3|Prp22_DM      QREQEIEAMP-TSLNKNWIDPLPEDESRSLAAN-MRGMAAAPPEVPEWKKHVIGGKKSSF

Q09530|MOG5_CE       QRERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATY

P24384|PRP22_SC      KREIEQQIRK----QQSFDDPTKNKKDSRNEIQ----MLKNQLIVTEWEKNRMN-ESISY

                     :** : :       :    **    :.     :           :.** *:     . ::

 

Q14562|DHX8_HS       GKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSR

A2A4P0|DHX8_MM       GKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSR

A1Z9L3|Prp22_DM      GKKTDLTLVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTAR

Q09530|MOG5_CE       GRRTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRR

P24384|PRP22_SC      GKRTSLPISAQRQTLPVYAMRSELIQAVRDNQFLVIVGETGSGKTTQITQYLDEEGFSNY

                     *::*.:.:  **::**:: ::.:*::*: ***:*:::**********:***  * *   

 

Q14562|DHX8_HS       GKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLREC

A2A4P0|DHX8_MM       GKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLREC

A1Z9L3|Prp22_DM      GKIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLREC

Q09530|MOG5_CE       GKIGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLREC

P24384|PRP22_SC      GMIGCTQPRRVAAVSVAKRVAEEVGCKVGHDVGYTIRFEDVTGPDTRIKYMTDGMLQREA

                     * ***********:******:** ** :* :********* *. :* ********* **.

 

Q14562|DHX8_HS       LIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFY

A2A4P0|DHX8_MM       LIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFY

A1Z9L3|Prp22_DM      LMEAELKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFF

Q09530|MOG5_CE       LIDPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFL

P24384|PRP22_SC      LLDPEMSKYSVIMLDEAHERTVATDVLFALLKKAAIKRPELKVIVTSATLNSAKFSEYFL

                     *::.::. *::**********: *****.*** :. ** ::*:*:*****::.***:**

 

Q14562|DHX8_HS       EAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTAC

A2A4P0|DHX8_MM       EAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTAC

A1Z9L3|Prp22_DM      KAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTAC

Q09530|MOG5_CE       EAPIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSC

P24384|PRP22_SC      NCPIINIPGKTFPVEVLYSQTPQMDYIEAALDCVIDIHINEGPGDILVFLTGQEEIDSCC

                     :.**:.***:*:***:**:: *: **::*:   *::**: * ***:*:*********:.*

 

Q14562|DHX8_HS       EILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDG

A2A4P0|DHX8_MM       EILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDG

A1Z9L3|Prp22_DM      EILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDG

Q09530|MOG5_CE       EVLYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDG

P24384|PRP22_SC      EILYDRVKTLGDSIGELLILPVYSALPSEIQSKIFEPTPKGSRKVVFATNIAETSITIDG

                     *:**:*:*::* .: **:*****.*****:*::**:*:* *.****:********:****

 

Q14562|DHX8_HS       IYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRD

A2A4P0|DHX8_MM       IYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRD

A1Z9L3|Prp22_DM      IFYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRD

Q09530|MOG5_CE       IFYVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRD

P24384|PRP22_SC      IYYVVDPGFAKINIYNARAGIEQLIVSPISQAQANQRKGRAGRTGPGKCYRLYTESAFYN

                     *:*******.* ::**.::*::.*:*:***** *:** ********** ****** *: :

 

Q14562|DHX8_HS       EMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDE

A2A4P0|DHX8_MM       EMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDE

A1Z9L3|Prp22_DM      EMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDE

Q09530|MOG5_CE       EMLPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGD

P24384|PRP22_SC      EMLENTVPEIQRQNLSHTILMLKAMGINDLLKFDFMDPPPKNLMLNALTELYHLQSLDDE

                     *** . ****** **: *:* **:****:*: *****.** : :: *:  *: * :**.:

 

Q14562|DHX8_HS       GLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQ

A2A4P0|DHX8_MM       GLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQ

A1Z9L3|Prp22_DM      GLLTRLGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQ

Q09530|MOG5_CE       GLLTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQ

P24384|PRP22_SC      GKLTNLGKEMSLFPMDPTLSRSLLSSVDNQCSDEIVTIISMLSVQNVFYRPKDRQLEADS

                     * **.**:.*: **::* *.: *: **   **:*::**::**.***:*****::*  **.

 

Q14562|DHX8_HS       KKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHK

A2A4P0|DHX8_MM       KKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHK

A1Z9L3|Prp22_DM      KKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHK

Q09530|MOG5_CE       KKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHK

P24384|PRP22_SC      KKAKFHHPYGDHLTLLNVYTRWQQANYSEQYCKTNFLHFRHLKRARDVKSQISMIFKKIG

                     *****::. ******* **. *:: ::*: :*  **:: * ::*::*::.*:  *:.: 

 

Q14562|DHX8_HS       LDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVV

A2A4P0|DHX8_MM       LDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVV

A1Z9L3|Prp22_DM      LDVVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVI

Q09530|MOG5_CE       LLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVV

P24384|PRP22_SC      LKLISCHSDPDLIRKTFVSGFFMNAAKRDSQVGYKTINGGTEVGIHPSSSLYGKEYEYVM

                     * ::*.  .   ::*:: **** ****:*.* **:*: .   * *****: : :: *:*:

 

Q14562|DHX8_HS       YHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYE-EPN

A2A4P0|DHX8_MM       YHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYE-EPN

A1Z9L3|Prp22_DM      YHELVQTTKEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLYNKYE-EPN

Q09530|MOG5_CE       YHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYA-DAN

P24384|PRP22_SC      YHSIVLTSREYMSQVTSIEPQWLLEVAPHFYKAGDAESQS--RKKAKIIPLHNKFAKDQN

                     **.:* *::*** :**:*:*:**:*.** *:: .*. . *  ::: :: **.:::  : *

 

Q14562|DHX8_HS       AWRISRAFRRR--------

A2A4P0|DHX8_MM       AWRISRAFRRR--------

A1Z9L3|Prp22_DM      AWRISRVRRRRN-------

Q09530|MOG5_CE       AWRITRVKKRIYNPNK---

P24384|PRP22_SC      SWRLSSIRQSRERALGIKR

                     :**::   :