S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Prp2p
YNR011C
DHX16
mog-4
CG10689 DHX16
DHX16
Database Links
Cellular Function pre-mRNA splicing pre-mRNA splicing

Group Alignment

O60231|DHX16_HS            MATPAGLERWVQDELHSVLGLSERHVAQFLIGTAQRCTSAEEFVQRLRDT

Q921Y1|DHX16_Mm            MATPAGLERWVQEELHSVLGLSERHVAQFLIGTAQRCASAEEFVQRLRDT

Q9VIZ3|DHX16_Dm            --------------------------------------------------

O45244|DHX16_mog-4_CE      ----MSVEQFINDQLHSIVGISDRSICQYVHALAKKAKSAPDLVEKLRDA

P20095|Prp2p_sc            --------------------------------------------------

                                                                             

 

O60231|DHX16_HS            DTLDLSGPARDFALRLWNKVPRKAVVEKP--ARAAEREARALLEKNRSYR

Q921Y1|DHX16_Mm            DTLDLGGPARDFALKLWSKVPRKAVVEKP--ARAAEREARALLEKNRSYK

Q9VIZ3|DHX16_Dm            --------------------------------------------------

O45244|DHX16_mog-4_CE      GDFPISPAIQSFADQLMSRMPRQATSARQRGPTTAELAEQELNRLNRAVG

P20095|Prp2p_sc            --------------------------------------------------

                                                                            

 

O60231|DHX16_HS            LLEDSEESSEETVSRAGSSLQKKRKKRKHLRKKR---EEEEEEEASEKGK

Q921Y1|DHX16_Mm            LLEDSE-SGEEAVGSNGSSLQKKRKRRKHLRKKHQEDEEDEEEEVSESGK

Q9VIZ3|DHX16_Dm            --------------------------------------------MSGKNR

O45244|DHX16_mog-4_CE      VLEDYS---------ASSTKTKNVRKRK---------ESSSEDDEAPIKA

P20095|Prp2p_sc            ----------------------------------------MSSITSETGK

                                                                        :   

 

O60231|DHX16_HS            KKTGGSKQQTE-KPESEDEWERTERERLQDLEERDAFAERVRQRDKDRTR

Q921Y1|DHX16_Mm            RKAGGSKSPTEEKPASEDEWERTERERLQDLEERDAFAERVRQRDKDRTR

Q9VIZ3|DHX16_Dm            KRTASSSSSGE-EPDSE------EESRLKDLQERDEFASRLKKRDDDRTR

O45244|DHX16_mog-4_CE      SKPGKSVKPSK-SDDSESDIEAMEAKLDADIAERDALAARINKKEKDKTR

P20095|Prp2p_sc            RRVKRTYEVTR-QNDNAVRIEPSSLGEEEDKEAKDKNSALQLKRSRYDPN

                            :   : .  . .  .       .     *   :*  :    ::.   ..

 

O60231|DHX16_HS            NVLERSD-KKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKL

Q921Y1|DHX16_Mm            NVLERSD-KKAYEEAQKRLKMAEEDRKAMVPELRKKSRREYLAKREREKL

Q9VIZ3|DHX16_Dm            NVVDSTGGRRAIEEATKRLKLEHEDRDKIVPHLRLQSRRQYLEKRKDDKV

O45244|DHX16_mog-4_CE      NVMEKKR------DDNK------DKEGSSMDKLREESRRQYLKKRKVDKL

P20095|Prp2p_sc            KVFSNTN------------------QGPEKNNLKGEQLGSQKKSSKYDEK

                           :*.. .                   .     .*: :.  .   . : ::

 

O60231|DHX16_HS            EDLEAELADEEFLFGDVE-LSRHERQELKYKRRVRDLAREYRAAGEQEKL

Q921Y1|DHX16_Mm            EDLEAELADEEVLFGDVE-LSRHERRELKYKRRVRDLAREYRAAGEQEKL

Q9VIZ3|DHX16_Dm            AELEADILDDEYLFDESV-LTKREKEEREYKKQLLNIAKEHEKAR---EL

O45244|DHX16_mog-4_CE      EELEAIVHDDQTLFAREK-LTKREKADMEYRKKVLEYTKAHGKAG---DV

P20095|Prp2p_sc            ITSNNELTTKKGLLGDSENETKYASSNSKFNVEVTHKIKNAK------EI

                              :  :  .: *:      ::    : ::. .: .  :         .:

 

O60231|DHX16_HS            EATNRYHMPKETRGQPARAVDLVEEESGAPGEEQRRWEEARLGAASLKFG

Q921Y1|DHX16_Mm            EATNRYHMPKETRGQPARTVDIVEEESGAPGEEQRRWEEAQLGAASLKFG

Q9VIZ3|DHX16_Dm            ERIQRYNMPQDLKKGERSEYVEVDEFEKQPNSEQKKWEAEQLASARFHFG

O45244|DHX16_mog-4_CE      MKMKRYHLPDASTKQIPSQYVEDDEEDFRPGGDGAKWEEEQLMASMLHLG

P20095|Prp2p_sc            DKINRQRMWEEQQLRN-AMAGQSDHPDDITLEGSDKYDYVFDTDAMIDYT

                              :* .: .             :. .  .     :::      : :. 

 

O60231|DHX16_HS            ARDAASQEPKYQLVLEEEETIEFVRATQLQGDEEPSA---PPTSTQAQQK

Q921Y1|DHX16_Mm            ARDAAAQEAKYQLVLEEDETIEFVRAAQLQGDEELSG---PPLSAQAQQK

Q9VIZ3|DHX16_Dm            AKDAKAEE-EYELLLDDQ--IDFIQALTLDGSREKSSSRQPELTEKERKR

O45244|DHX16_mog-4_CE      AKDAKRKEQEFELLLDEK--VDFIQALQMPGTNEEVV-----ETEAEKKK

P20095|Prp2p_sc            NEED-------DLLPEEKLQYEARLAQALETE--------------EKRI

                            .:        :*: ::.   :   *  :                  ::

 

O60231|DHX16_HS            ESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEE

Q921Y1|DHX16_Mm            ESIQAVRRSLPVFPFREELLAAIANHQVLIIEGETGSGKTTQIPQYLFEE

Q9VIZ3|DHX16_Dm            LTLDETRRSLPVYPFKEDLIAAVKEHQVLIIEGETGSGKTTQVPQYLVEA

O45244|DHX16_mog-4_CE      MSIEETRKSLPVYAFRDAFIEAVKEHQVLIIEGETGSGKTTQLPQYLYEA

P20095|Prp2p_sc            LTIQEARKLLPVHQYKDELLQEIKKNQVLIIMGETGSGKTTQLPQYLVED

                            ::: .*: ***. ::: ::  : ::***** **********:**** *

 

O60231|DHX16_HS            GYTNKG-MKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTS

Q921Y1|DHX16_Mm            GYTKKG-MKIACTQPRRVAAMSVAARVAREMGVKLGNEVGYSIRFEDCTS

Q9VIZ3|DHX16_Dm            GFTKDK-KMIGCTQPRRVAAMSVAARVAEEMGVKLGNEVGYSIRFEDCTS

O45244|DHX16_mog-4_CE      GFCEGG-KRIGCTQPRRVAAMSVAARVADEVGCKLGTQVGYSIRFEDCTS

P20095|Prp2p_sc            GFTDQGKLQIAITQPRRVAATSVAARVADEMNVVLGKEVGYQIRFEDKTT

                           *: .     *. ******** ******* *:.  **.:***.***** *:

 

O60231|DHX16_HS            -ERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIK

Q921Y1|DHX16_Mm            -ERTVLRYMTDGMLLREFLSEPDLASYSVVMVDEAHERTLHTDILFGLIK

Q9VIZ3|DHX16_Dm            -DRTILKYMTDGTLHREFLSEPDLASYSVMIIDEAHERTLHTDILFGLVK

O45244|DHX16_mog-4_CE      -EKTVLKYMTDGMLLREFLNEPDLASYSVMMIDEAHERTLHTDILFGLVK

P20095|Prp2p_sc            PNKTVLKYMTDGMLLREFLTDSKLSKYSCIMIDEAHERTLATDILIGLLK

                            ::*:*:***** * ****.:..*:.** :::******** ****:**:*

 

O60231|DHX16_HS            DVARFRPELKVLVASATMDTARFSTFFDDAPVFRIPGRRFPVDIFYTKAP

Q921Y1|DHX16_Mm            DVARFRPELKVLVASATLDTARFSAFFDDAPVFRIPGRRFPVDIFYTKAP

Q9VIZ3|DHX16_Dm            DIARFRPELKLLISSATLDAEKFSAFFDDAPIFRIPGRRYPVDIFYTKAP

O45244|DHX16_mog-4_CE      DIARFRKDLKLLISSATLDAEKFSSFFDDAPIFRIPGRRFPVDIYYTQAP

P20095|Prp2p_sc            DILPQRPTLKLLISSATMNAKKFSEFFDNCPIFNVPGRRYPVDIHYTLQP

                           *:   *  **:*::***::: :** ***:.*:*.:****:****.**  *

 

O60231|DHX16_HS            EADYLEACVVSVLQIHVTQPP-GDILVFLTGQEEIEAACEMLQDRCRRLG

Q921Y1|DHX16_Mm            EADYLEACVVSVLQIHVTQPP-GDILVFLTGQEEIEAACEMLQDRCRRLG

Q9VIZ3|DHX16_Dm            EADYIDACCVSVLQIHATQPL-GDILVFLTGQDEIETCQEVLHDRVKRLG

O45244|DHX16_mog-4_CE      EADYVDAAIVTIMQIHLTQPLPGDILVFLTGQEEIETVQEALMERSKALG

P20095|Prp2p_sc            EANYIHAAITTIFQIHTTQSLPGDILVFLTGQEEIERTKTKLEEIMSKLG

                           **:*:.*. .:::*** **.  **********:***     * :    **

 

O60231|DHX16_HS            SKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGI

Q921Y1|DHX16_Mm            SKIRELLVLPIYANLPSDMQARIFQPTPPGARKVVVATNIAETSLTIEGI

Q9VIZ3|DHX16_Dm            SKIRELIVIPVYANLPSDMQAKIFEPTPPNARKVILATNIAETSLTIDNI

O45244|DHX16_mog-4_CE      SKIKELIPLPVYANLPSDLQAKIFEPTPKDARKVVLATNIAETSVTIDGI

P20095|Prp2p_sc            SRTKQMIITPIYANLPQEQQLKIFQPTPENCRKVVLATNIAETSLTIDGI

                           *: ::::  *:*****.: * :**:*** ..***::********:**:.*

 

O60231|DHX16_HS            IYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFR

Q921Y1|DHX16_Mm            IYVLDPGFCKQKSYNPRTGMESLTVTPCSKASANQRAGRAGRVAAGKCFR

Q9VIZ3|DHX16_Dm            IYVIDPGFAKQNNFNSRTGMESLMVVPISKASANQRAGRAGRTAPGKCFR

O45244|DHX16_mog-4_CE      NYVIDPGFSKQNSFDARSGVEHLHVVTISKAAANQRAGRAGRTGPGKCFR

P20095|Prp2p_sc            RYVIDPGFVKENSYVPSTGMTQLLTVPCSRASVDQRAGRAGRVGPGKCFR

                            **:**** *::.: . :*:  * ... *:*:.:********...*****

 

O60231|DHX16_HS            LYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPY

Q921Y1|DHX16_Mm            LYTAWAYQHELEETTVPEIQRTSLGNVVLLLKSLGIHDLMHFDFLDPPPY

Q9VIZ3|DHX16_Dm            LYTAWAYKHELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPH

O45244|DHX16_mog-4_CE      LYTAWAYKHELEEQPIPEIQRTNLGNVVLMLKSLGIHDLVHFDFLDPPPQ

P20095|Prp2p_sc            IFTKWSYLHELELMPKPEITRTNLSNTVLLLLSLGVTDLIKFPLMDKPSI

                           ::* *:* ****  . *** * .*.*.**:* :**: **::* ::* *.

 

O60231|DHX16_HS            ETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYS-

Q921Y1|DHX16_Mm            ETLLLALEQLYALGALNHLGELTTSGRKMAELPVDPMLSKMILASEKYS-

Q9VIZ3|DHX16_Dm            ETLVLALEQLYALGALNHHGELTKLGRRMAEFPVDPMMGKMLLASEKYK-

O45244|DHX16_mog-4_CE      ETLVIALEQLYALGALNHRGELTKLGRRMAEFPCDPCMSKMIIASEKYE-

P20095|Prp2p_sc            PTLRKSLENLYILGALNSKGTITRLGKMMCEFPCEPEFAKVLYTAATHEQ

                            **  :**:** *****  * :*  *: *.*:* :* :.*:: :: .:.

 

O60231|DHX16_HS            CS---EEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLL

Q921Y1|DHX16_Mm            CS---EEILTVAAMLSVNNSIFYRPKDKVVHADNARVNFFLPGGDHLVLL

Q9VIZ3|DHX16_Dm            CS---EEMVTIAAMLSVNSAIFYRPKDKIIHADTARKNFNHMHGDHLSLL

O45244|DHX16_mog-4_CE      CS---EEIVTIAAMLSCNAAVFYRPKAQVIHADSARKGFWSPAGDHITLM

P20095|Prp2p_sc            CQGVLEECLTIVSMLHETPSLFIGQK-----RDAAASVLSEVESDHILYL

                           *.   ** :*:.:**  . ::*   *      * *   :    .**:  :

 

O60231|DHX16_HS            NVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLSSC

Q921Y1|DHX16_Mm            NVYTQWAESGYSSQWCYENFVQFRSMRRARDVREQLEGLLERVEVGLTSC

Q9VIZ3|DHX16_Dm            QVYNQWAETDYSTQWCYENFIQYRSMKRARDVREQLVGLMQRVEIDMVSC

O45244|DHX16_mog-4_CE      NVYNKWQESSFSQRWCVENYVQHRTMKRARDVRDQLVGLLERVEIETKSS

P20095|Prp2p_sc            EIFNQWRNSKFSRSWCQDHKIQFKTMLRVRNIRNQLFRCSEKVGLVEKND

                           :::.:* :: :*  ** :: :*.::* *.*::*:**    ::* :   .

 

O60231|DHX16_HS            QG----------DYIRVRKAITAGYFYHTARLTRSG-YRTVKQQQ---TV

Q921Y1|DHX16_Mm            QG----------DYVRVRKAITSGYFYHTARLTRSG-YRTVKQQQ---TV

Q9VIZ3|DHX16_Dm            LP----------ETVNVRKAATAGYFYHVARLSKGGHYKTIKHNQ---TV

O45244|DHX16_mog-4_CE      T-----------DTIKIRKAITAGYFYNVSKLDNTGHYKTVKHKH---TT

P20095|Prp2p_sc            QARMKIGNIAGYINARITRCFISGFPMNIVQLGPTG-YQTMGRSSGGLNV

                                          .: :.  :*:  :  :*   * *:*: :.    ..

 

O60231|DHX16_HS            FIHPNSSLFE------QQP-RWLLYHELVLTTKEFMRQVLEIES-SWLLE

Q921Y1|DHX16_Mm            FIHPNSSLFE------QQP-RWLLYHELVLTTKEFMRQVLEIES-SWLLE

Q9VIZ3|DHX16_Dm            MIHPNSSLFE------ELP-RWVLYHELVFTSKEYMRQVIEIES-KWLLE

O45244|DHX16_mog-4_CE      HPHPNSCLFE------ETP-RWVVYFELVFTSKEFMREMSEIES-GWLLE

P20095|Prp2p_sc            SVHPTSILFVNHKEKAQRPSKYVLYQQLMLTSKEFIRDCLVIPKEEWLID

                             **.* **       : * ::::* :*::*:**::*:   * .  **::

 

O60231|DHX16_HS            VAPHYYKAKELEDPHAKKMPKKIGKTREELG-

Q921Y1|DHX16_Mm            VAPHYYKAKELEDPHAKKMPKKVGKTREELG-

Q9VIZ3|DHX16_Dm            VAPHYYKAKELEDSTNKKMPKVAGRAEMAQ--

O45244|DHX16_mog-4_CE      VAPHYYKGRELEDATNKKMPKNKGKSGKDLER

P20095|Prp2p_sc            MVPQIFK--DLIDDKTNRGRR-----------

                           :.*: :*  :* *   ::  :