S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Prp16
YKR086W
Mog1 CG32604 DDX38
DDX38
Prp16
Database Links
Cellular Function pre-mRNA splicing pre-mRNA splicing

Group Alignment

Q80X98|DHX38_Mm       MEDPGEDTSIHRLEGTSLDSQVGGLICKTK--SAANEQHVFKAPAPRPSLLGLDLLASLK

Q92620|DHX38_Hs       MGDTSEDASIHRLEGTDLDCQVGGLICKSK--SAASEQHVFKAPAPRPSLLGLDLLASLK

Q9VY54|Prp16_Dm       -KERSE--RLISFKDSEFDDTGGGSSTPQANASGASSEFAFKKPDTKS-------FEKLR

P34498|MOG1_Ce        ---MSDKRADGRLEGT--SDTFGGLVIKKK---KVEGDSKPTEPSGKS-------LLGLD

P15938|PRP16p_Sc      ---MGHSGREERIKDIFKELTSKELTPGLL--------LTLQKLAQKP-------NTNLE

                          ..      ::.   .                           :.          *

 

Q80X98|DHX38_Mm       RREREEKDDGEDKKKSRVSSYKDWEESKDDQKDAEEESEDQAGRSSRRDRHYRSARVETP

Q92620|DHX38_Hs       RREREEKDDGEDKKKSKVSSYKDWEESKDDQKDAEEEGGDQAGQNIRKDRHYRSARVETP

Q9VY54|Prp16_Dm       GQLREHKDDTPSHTGG-----------------VSEKARERLREHIQRDR--KRGPVSST

P34498|MOG1_Ce        RLASTKR----------------------------EHARKRLEDD--DDR-----GVTES

P15938|PRP16p_Sc      QFIASCK------------------------------ALTKLSSN---------------

                            :                              .  :                  

 

Q80X98|DHX38_Mm       SHPGGVSEEFWERSRQRERDRREHGVYASSKEEKDRKKERSRDRDYDRKRDRADERDRSR

Q92620|DHX38_Hs       SHPGGVSEEFWERSRQRERERREHGVYASSKEEKDWKKEKSRDRDYDRKRDR-DERDRSR

Q9VY54|Prp16_Dm       AAEGRDRDRDWDRDRRRDRDR-------DRDRDRDRRQHRERERDRHRSWDRDRGRDRDR

P34498|MOG1_Ce        VRKG------IEKVHEKHRDR-----------DDRGMKYKSRDDDRRRDRDRSERREPSS

P15938|PRP16p_Sc      ----------------------------------NPIIFNELLELLKNKSEEDSTGPKKI

                                                             ..      .. :.      .

 

Q80X98|DHX38_Mm       HSSRSDRDGGSERSSRRNEPESPRHRPKDAATPSRSAWEEDDSGYGSSRRSQWETPSPTP

Q92620|DHX38_Hs       HSSRSERDGGSERSSRRNEPESPRHRPKDAATPSRSTWEEEDSGYGSSRRSQWESPSPTP

Q9VY54|Prp16_Dm       DRSMSERSVHTPR-----EPGTPGG---SSGGISNSSWDDEDGEFGQ-RKSDWDMPTPR-

P34498|MOG1_Ce        RRGWKDRSG----------DQTPRFK--VPDTPSRMSWDQDDREGSSRKRNSWDMPTPRG

P15938|PRP16p_Sc      APSINKRKK------------------------FKIQLDLDDN------EDELDSPVQKK

                        . ..*.                          .   : :*       ... : *   

 

Q80X98|DHX38_Mm       SYRDSERGHRPSTRDRDRSIRSKSSDDTPLPTPSYKYNEWADDRRHLGSTPRLSRGRGRR

Q92620|DHX38_Hs       SYRDSERSHRLSTRDRDRSVRGKYSDDTPLPTPSYKYNEWADDRRHLGSTPRLSRGRGRR

Q9VY54|Prp16_Dm       --RHGNKSGDWSVRSGGSRRNHGRQDDTVRPTPAHRYNQWAHGRKRSGATP---------

P34498|MOG1_Ce        E-RDRKRYMDSERSISSAWRSERRNRDDEKRRRHRKPEDSVRSVKEEKAEP---------

P15938|PRP16p_Sc      PAPTRTLFKRIDKLKAKQLRQYSPTVKDPSPNSEQQTQNGHAETKDYEPTR---------

                                 .              .        : ::     :   .          

 

Q80X98|DHX38_Mm       EDGEEGIAFDTEEERQQWEDDQRQADRDWYMMDEGYDEFHNPLAYSSEDYVRRREQHLHK

Q92620|DHX38_Hs       EEGEEGISFDTEEERQQWEDDQRQADRDWYMMDEGYDEFHNPLAYSSEDYVRRREQHLHK

Q9VY54|Prp16_Dm       -WGED------PESLDLWEEEQRRLDREWYNIDEGYDDENNPFGGPNSEYFRKREEQLEQ

P34498|MOG1_Ce        -------TFHDDEERAQWEEEQKNLDREWYDNEGAFDDEYNPFNKVSDEFVEKREKQWQE

P15938|PRP16p_Sc      -------------------SEVVEEDREWYDND--------------DDYGNLVPEPLSE

                                         .:  . **:**  :              .:: .   :   :

 

Q80X98|DHX38_Mm       QKQK-RISAQRRQINEDNERWETNRMLTSGVVHRL-EVDEDFEEDN-AAKVHLMVHNLVP

Q92620|DHX38_Hs       QKQK-RISAQRRQINEDNERWETNRMLTSGVVHRL-EVDEDFEEDN-AAKVHLMVHNLVP

Q9VY54|Prp16_Dm       KRTK-RISAQQRQNNRDNELWERNRMLTSGVVTLI-SVNDDFDEEA-LERVHLLVHHIIP

P34498|MOG1_Ce        KTQKPRLTVKQQAIKRENELWENNRLHRSGVVAMADELSSIFEDETDENRVTILVQNIVP

P15938|PRP16p_Sc      LPEEAKLLPVIRNIDNDDALRNTVQLYPIPLKQRMEWIPPFLSKFALENKVP---TSIII

                         : ::    :  ..::   :  ::    :      :   :..     :*      ::

 

Q80X98|DHX38_Mm       PFLDGRIVFTKQPEPVIPVKDATSDLAIIARKGSQTVRKHREQKERRKAQHKHWELAGTK

Q92620|DHX38_Hs       PFLDGRIVFTKQPEPVIPVKDATSDLAIIARKGSQTVRKHREQKERKKAQHKHWELAGTK

Q9VY54|Prp16_Dm       PFLDGRIVFTKQPEPVVPVKDPTSDMALLARKGSALVRNYREQKERRKAQKKHWELSGTK

P34498|MOG1_Ce        PFLDGRIVFTKQAQPIIPVVDTTCDMAVSAARGSVAVRKRREVEDRKKAQDKHWELAGSK

P15938|PRP16p_Sc      GSISETSSQVSALSMVNPFRNPDSEFSANAKRGSKLVALRRINMEHIQQSRDNTTVLNTA

                        :.     ..  . : *. :. .:::  * :**  *   *   :: : . .:  : .:

 

Q80X98|DHX38_Mm       LGDIMGVKKEEEPD--KAMTEDGKVDYRTEQKFADHMKEK-SEASSEFAKKKSILEQRQY

Q92620|DHX38_Hs       LGDIMGVKKEEEPD--KAVTEDGKVDYRTEQKFADHMKRK-SEASSEFAKKKSILEQRQY

Q9VY54|Prp16_Dm       LGNIMGVQRPQDEDDMRFDKEKDKADYRKDQKFADHMRDQDTGGKSDFSRKKTISEQRRF

P34498|MOG1_Ce        LGNLMGVKEKKDET--ADPEDDDSGNYKESHQFASHMKDN--EAVSDFAMEKSIKQQREY

P15938|PRP16p_Sc      MGEVLGLENNNKAK------DKSNQKICDDTALFTPSKDD-------------IKHTKEQ

                      :*:::*::. :.        :... .   .  :    : .             * . :.

 

Q80X98|DHX38_Mm       LPIFAVQQELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYT-DYG-MIGCTQPRRVA

Q92620|DHX38_Hs       LPIFAVQQELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYT-DYG-MIGCTQPRRVA

Q9VY54|Prp16_Dm       LPVFASRQELLNVIRENSVIIIVGETGSGKTTQLTQYLHEDGYS-KRG-MIGCTQPRRVA

P34498|MOG1_Ce        LPVFACRQKMMNVIRENNVVIIVGETGSGKTTQLAQYLLEDGFG-DSG-LIGCTQPRRVA

P15938|PRP16p_Sc      LPVFRCRSQLLSLIRENQVVVIIGETGSGKTTQLAQYLYEEGYANDRGKSIVVTQPRRVA

                      **:*  :.:::.:**:*.:::::***********:*** *:*:  . *  *  *******

 

Q80X98|DHX38_Mm       AMSVAKRVSEEMGGNLGEEVGYAIRFEDCT-SENTLIKYMTDGILLRESLREADLDHYSA

Q92620|DHX38_Hs       AMSVAKRVSEEMGGNLGEEVGYAIRFEDCT-SENTLIKYMTDGILLRESLREADLDHYSA

Q9VY54|Prp16_Dm       AMSVAKRVSDEMDTQLGEDVGYAIRFEDCT-SERTVIKYMTDGILLRESLRDPELDSYSA

P34498|MOG1_Ce        AMSVARRVADEMGVDLGQDVGYAIRFEDCT-SEKTIIKYMTDGILLRECLGDGSLDQYSA

P15938|PRP16p_Sc      AISVAKRVAMEMQVPLGKEVGYSIRFEDVTDSECTKLKFVTDGILLRETLLDDTLDKYSC

                      *:***:**: **   **::***:***** * ** * :*::******** * :  ** **.

 

Q80X98|DHX38_Mm       VIMDEAHERSLNTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFG-NVPIFHIPGR

Q92620|DHX38_Hs       IIMDEAHERSLNTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFG-NVPIFHIPGR

Q9VY54|Prp16_Dm       IIMDEAHERSLSTDVLFGLLREIVARRHDLKLIVTSATMDSSKFATFFG-NVPTFTIPGR

P34498|MOG1_Ce        IIMDEAHERSLNTDVLFGLLREVIAKRADLKLIVTSATMDADKFADFFGGNCPTFTIPGR

P15938|PRP16p_Sc      VIIDEAHERSLNTDILLGFFKILLARRRDLKLIITSATMNAKKFSAFFG-NAPQFTIPGR

                      :*:********.**:*:*::: ::*:* *****:*****::.**: *** * * * ****

 

Q80X98|DHX38_Mm       TFPVDILFSKTPQEDYVEAAVKQSLQVHLS--GAPGDILIFMPGQEDIEVTSDQIVEH--

Q92620|DHX38_Hs       TFPVDILFSKTPQEDYVEAAVKQSLQVHLS--GAPGDILIFMPGQEDIEVTSDQIVEH--

Q9VY54|Prp16_Dm       TFPVDVMFSKNTCEDYVESAVKQALQVHLT--PNEGDMLIFMPGQEDIEVTCEVLEER--

P34498|MOG1_Ce        TFPVELFHARTPVEDYVDAAVKQAVTIHLG--GMDGDILIFMPGQEDIECTCEMIKEK--

P15938|PRP16p_Sc      TFPVQTIYTSNPVQDYVEAAVSQAVKIHLANDCSSGDILIFMTGQEDIETTFDTLQEKFL

                      ****: :.: .. :***::**.*:: :**      **:****.****** * : : *: 

 

Q80X98|DHX38_Mm       --------LEELENAPALAVLPIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVD

Q92620|DHX38_Hs       --------LEELENAPALAVLPIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVD

Q9VY54|Prp16_Dm       --------LAEIDNAPALSILPIYSQLPSDLQAKIFQKSSDGLRKCVVATNIAETSLTVD

P34498|MOG1_Ce        --------LGELDEAPPLAVLPIYSQLPSDLQAKIFQRAPGGMRKAIVATNIAETSLTVD

P15938|PRP16p_Sc      QVYSKKFGTANFEEINDIEILPIYSALPADLQFKIFQDLHGTKRKIIIATNIAETSLTIK

                                ::::   : :***** **:*** ****   .  ** ::**********:.

 

Q80X98|DHX38_Mm       GIMFVIDSGYCKLKVFNPRIGMDALQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYK

Q92620|DHX38_Hs       GIMFVIDSGYCKLKVFNPRIGMDALQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYK

Q9VY54|Prp16_Dm       GIIYVIDSGYCKLKVYNPRIGMDALQIYPISQANANQRSGRAGRTGPGQAYRLYTQRQYK

P34498|MOG1_Ce        GILFVIDPGFCKMKVYNPRIGMDALSIFPVSQASANQRTGRAGRTGPGQCYRLYTERQFK

P15938|PRP16p_Sc      GIRYVIDCGYSKLKVYNPKIGLDSLVITPISKANADQRSGRAGRTAPGTAYRLYTEDTFK

                      ** :*** *:.*:**:**:**:*:* * *:*:*.*:**:******.** .:****:  :*

 

Q80X98|DHX38_Mm       NELLTTTVPEIQRTNLANVVLLLKSLGVQDLL-QFHFMDPPPEDNMLNSMYQLWILGALD

Q92620|DHX38_Hs       NELLTTTVPEIQRTNLANVVLLLKSLGVQDLL-QFHFMDPPPEDNMLNSMYQLWILGALD

Q9VY54|Prp16_Dm       DELLALTVPEIQRTNLANTVLLLKSLGVVDLL-QFHFMDPPPQDNILNSLYQLWILGALD

P34498|MOG1_Ce        DELLKSTVPEIQRTNLANVVLLLKSLGVDDLL-KFHFMDAPPQDNMLNSMYQLWTLGALD

P15938|PRP16p_Sc      EDMYLQTIPEIQRTNLSNTLLLLKSLDVTDELSKFPFIDKPPLQTFLSSLYELWFIGAID

                      :::   *:********:*.:******.* * * :* *:* ** :.:*.*:*:** :**:*

 

Q80X98|DHX38_Mm       NTGGLTSTGRLMVEFPLDPALSKMLIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEES

Q92620|DHX38_Hs       NTGGLTSTGRLMVEFPLDPALSKMLIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEES

Q9VY54|Prp16_Dm       HTGALTTLGRQMAEFPLDPPQCQMLIVACRMGCSAEVLIIVSMLSVPSIFYRPKGREDEA

P34498|MOG1_Ce        NTGQLTPMGRKMVEFPLDPTLSKMLIMSAEMGCSDEVLTIVSMLSVPAIFFRPKGREEEA

P15938|PRP16p_Sc      TSGQLTPLGLQMAKFPLQPSLSKILLIAVRNGCSDEMLTIVSMLSVPQVFYRPKERQKEA

                       :* **. *  *.:***:*. .::*:::   *** *:* ******** :*:*** *:.*:

 

Q80X98|DHX38_Mm       DQIREKFAVPESDHLTYLNVYLQWKNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQ

Q92620|DHX38_Hs       DQIREKFAVPESDHLTYLNVYLQWKNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQ

Q9VY54|Prp16_Dm       DGVREKFQRPESDHLTYLNVYQQWRQNNYSSTWCNEHFIHIKAMRKVREVRQQLKDIMTQ

P34498|MOG1_Ce        DAKKEKFQVPESDHLTFLNVYIQWRTHKYSAKWCADNYLHVKALKKVREVRAQLKEIMQD

P15938|PRP16p_Sc      DIARNKFFIAKSDHLTLLNVFEQWRANNFSSHWCNKHFVQYKSLVRARDIRDQLLTILKS

                      *  ::**  .:***** ***: **: :::*: ** .:::: *:: :.*::* **  *: .

 

Q80X98|DHX38_Mm       QRMSLASCGTDWDIVRKCICAAYFHQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTP

Q92620|DHX38_Hs       QRMSLASCGTDWDIVRKCICAAYFHQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTP

Q9VY54|Prp16_Dm       QNLSVISCGIDWDIVRKCICSAYFYQAARLKGIGEYVNLRTGMPCHLHPTSALYGLGTTP

P34498|MOG1_Ce        LKLPLISNGSEWDIVRKCICSAYFHNAARLKGIGEYVNVRTGIPCFLHPTSALFGMGFMP

P15938|PRP16p_Sc      QKIPVISSGKDWDIIKKCICSGFAHQAAKITGLRNYVHLKTGVSVQLHPTSALHGLGDLP

                       .:.: * * :***::****:.: ::**::.*: :**:::**:.  *****:*.*:*  *

 

Q80X98|DHX38_Mm       DYIVYHELVMTTKEYMQCVTAVDGEWLAELGPMFYSVKQAGKSRQENRR-----RAKEEA

Q92620|DHX38_Hs       DYIVYHELVMTTKEYMQCVTAVDGEWLAELGPMFYSVKQAGKSRQENRR-----RAKEEA

Q9VY54|Prp16_Dm       DYVVYHELIMTAKEYMQCATAVDGYWLAELGPMFFSVKESGRSGREKKK-----QAAEHL

P34498|MOG1_Ce        DYVVYHELIMTAKEYMQCVTAVDAIWLAELGPMFYSIKESKQSRKELKM-----ESVRTV

P15938|PRP16p_Sc      PYVVYHELLMTSKEYICCVTSVDPFWLMEYGGLLYDIKRIKNDQEATTTGLFGEHYEHTL

                       *:*****:**:***: *.*:**  ** * * :::.:*.  .. .         .  . 

 

Q80X98|DHX38_Mm       SAMEEEMALAEEQLRARRQEQEKRSPLGSVRSTKIYTPGRKEQGEPMTPRRTPARFGL--

Q92620|DHX38_Hs       SAMEEEMALAEEQLRARRQEQEKRSPLGSVRSTKIYTPGRKEQGEPMTPRRTPARFGL--

Q9VY54|Prp16_Dm       KEMEEQMLKAQHEMEERKQQAAEREEQ-LATKQEIATPGN------ATPRRTPARIGL--

P34498|MOG1_Ce        ETMEAEMREAQKEME-RRKEESDKAFKRPESSRRVVEVGSK-----SARSERRKLWGL--

P15938|PRP16p_Sc      DKVEDDIDINIRRCKDMRDSVIQELKMTDNSNKEDKKQKTKKQNILNGKENSMKPFKRRK

                      . :* ::    .. .  :..  ..       . .                .        

 

Q80X98|DHX38_Mm       ---

Q92620|DHX38_Hs       ---

Q9VY54|Prp16_Dm       ---

P34498|MOG1_Ce        ---

P15938|PRP16p_Sc      PFF