S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein DHX9
rha-1
MLE
CG11680
DHX9
mHEL-5 / NDH2
DHX9
LKP, NDH2
Database Links
Cellular Function
  • Transcription
  • Translation

in Bovin: DHX9 / NDH2

Group Alignment

Q08211|DHX9_HS         -MGDVKNFLYAWCGKRKMT-PSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQ

Q28141|DHX9_BOVIN      -MGDVKNFLYAWCGKRKMT-PSYEIRAVGNKNRQKFMCEVRVEGYNYTGMGNSTNKKDAQ

O70133|DHX9_MM         -MGDIKNFLYAWCGKRKMT-PAYEIRAVGNKNRQKFMCEVRVEGFNYAGMGNSTNKKDAQ

P24785|MLE_DM          --MDIKSFLYQFCAKSQIE-PKFDIRQTGPKNRQRFLCEVRVEPNTYIGVGNSTNKKDAE

Q22307|DHX9_CE         MSRDVKEFLYAWLGKNKYGNPTYDTKSETRSGRQRFKCELRITGFGYTAFGNSTNKKDAA

                          *:*.*** : .* :   * :: :    ..**:* **:::    * ..*********

 

Q08211|DHX9_HS         SNAARDFVNYLVRINEIKSEEVPAFGVASPPP-LTDTPDTTANAEGDLPTTMGGPLPPHL

Q28141|DHX9_BOVIN      SNAARDFVNYLVRINELKSEEVPAVGVAPPTP-SATDSSDTTAEDGGVPGNLGGPLPPHL

O70133|DHX9_MM         SNAARDFVNYLVRINEVKSEEVPAVGIVPPPPILSDTSDSTASAAEGLPAPMGGPLPPHL

P24785|MLE_DM          KNACRDFVNYLVRVGKLNTNDVPADAGASGGG------PRTGLEGAGMAGGSG---QQKR

Q22307|DHX9_CE         TNAAQDFCQYLVREGKMQQSDIPTLTSSSLEA-------SSTWQDSETATMFCGGEDGNS

                       .**.:** :**** .::: .::*:    .           :       .         :

 

Q08211|DHX9_HS         ALKAE-NNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNW

Q28141|DHX9_BOVIN      TLQAE-NNSGGGGSGY---VPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNW

O70133|DHX9_MM         ALKAEENNSGVESSGYGSPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNW

P24785|MLE_DM          VFDGQ---SGPQDLGEAYRPLNHDGGDGGNRYSVIDRIQEQRDMNEAEAFDVNAAIHGNW

Q22307|DHX9_CE         FQESQ---QPIPQKRFPWSNNAYQRNEGTHEQYIT---QKAEEIAASETVDLKSEIHGGW

                         ..:   .              : . . :        *: .    :* .*::: :**.*

 

Q08211|DHX9_HS         TLENAKARLNQYFQKEKIQGEYKYTQVG-PDHNRSFIAEMTIYIKQLGRRIFAREHGSNK

Q28141|DHX9_BOVIN      TLENAKARLNQYFQKEKIQGEYKYTQVG-PDHNRSFIAEMTIYIKQIGRRIFAREHGSNK

O70133|DHX9_MM         TLENAKARLNQYFQKEKIQGEYKYTQVG-PDHNRSFIAEMTIYIKQLGRRIFAREHGSNK

P24785|MLE_DM          TIENAKERLNIYKQTNNIRDDYKYTPVG-PEHARSFLAELSIYVPALNRTVTARESGSNK

Q22307|DHX9_CE         TMENSKKALNEFLQKMRLPQVNYGTKIRESNTVKTMETTAQIFVPQINKNLVGKGTGSNK

                       *:**:*  ** : *. .:      * :  .:  ::: :   *::  :.: : .:  ****

 

Q08211|DHX9_HS         KLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNL

Q28141|DHX9_BOVIN      KLAAQSCALSLVRQLYHLGVIEPYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIVQELNL

O70133|DHX9_MM         KLAAQSCALSLVRQLYHLGVIEAYSGLTKKKEGERVEPYKVFLSPDLELQLQNVVQELDL

P24785|MLE_DM          KSASKSCALSLVRQLFHLNVIEPFSGTLKKKKDEQLKPYPVKLSPNLINKIDEVIKGLDL

Q22307|DHX9_CE         KVSEAACAMNIVRQMFHLNIMQSYSGPIKKSKVSTLPEIAISIPEDLSTRVTEYVRSCGL

                       * :  :**:.:***::**.:::.:**  **.: . :    : :. :*  :: : ::  .*

 

Q08211|DHX9_HS         EILPPP------EDPSVPVALN--IGKLAQFEPS-QRQNQVGVVPWSPPQSNWNPWTSSN

Q28141|DHX9_BOVIN      EIVPIP------EDPSVPVALN--LGKLAQFEPS-QRQNPVGVVPWSPPQSNWNPWTSSN

O70133|DHX9_MM         EIVPPP------VDPSMPVILN--IGKLAHFEPS-QRQNAVGVVPWSPPQSNWNPWTSSN

P24785|MLE_DM          PVVNPRNIKIELDGPPIPLIVN--LSRIDSSQQDGEKRQESSVIPWAPPQANWNTWHACN

Q22307|DHX9_CE         ELPEIN------ETSATPEAPTSLLTDVKLAQFPVSEICSASNISWAPPLQNWNPWRASN

                        :            .. *   .  :  :   :   ..    . :.*:**  ***.* :.*

 

Q08211|DHX9_HS         IDEGPLAFATPEQISMDLKNELMYQLEQDHDLQAILQERELLPVKKFESEILEAISQNSV

Q28141|DHX9_BOVIN      IDEGPLAYATPEQISMDLKNELMYQLEQDRDLQAVLQERELLPVKKFESEILEAISQNPV

O70133|DHX9_MM         IDEGPLAYASTEQISMDLKNELTYQMEQDHNLQSVLQERELLPVKKFEAEILEAISSNSV

P24785|MLE_DM          IDEGELATTSIDDLSMDYERSLRDRRQNDNEYRQFLEFREKLPIAAMRSEILTAINDNPV

Q22307|DHX9_CE         IDEEPLAFMSMEQISQRIMEKEDFKRGE--ALDKITAQRGELPVAQYRENIVQTVAENRV

                       ***  **  : :::*    ..   :  :      .   *  **:   . :*: :: .* *

 

Q08211|DHX9_HS         VIIRGATGCGKTTQVPQFILDDFIQNDRAAECNIVVTQPRRISAVSVAERVAFERGEEPG

Q28141|DHX9_BOVIN      VIIRGATGCGKTTQVPQFILDDCIQNDRAAECNIVVTQPRRISAVSVAERVAYERGEEPG

O70133|DHX9_MM         VIIRGATGCGKTTQVPQYILDDFIQNDRAAECNIVVTQPRRISAVAVAERVAYERGEEPG

P24785|MLE_DM          VIIRGNTGCGKTTQIAQYILDDYICSGQGGYANIYVTQPRRISAISVAERVARERCEQLG

Q22307|DHX9_CE         TLIKGETGCGKSTQVAQFLLESFLENSNGASFNAVVSQPRRISAISLAERVANERGEEVG

                       .:*:* *****:**:.*::*:. : .....  *  *:*******:::***** ** *: *

 

Q08211|DHX9_HS         KSCGYSVRFESILPRPHASIMFCTVGVLLRKLEAGIRGISHVIVDEIHERDINTDFLLVV

Q28141|DHX9_BOVIN      KSCGYSVRFESILPRPHASIMFCTVGVLLRKLEAGIRGISHVIVDEIHERDINTDFLLVV

O70133|DHX9_MM         KSCGYSVRFESILPRPHASIMFCTVGVLLRKLEAGIRGISHVIVDEIHERDINTDFLLVV

P24785|MLE_DM          DTVGYSVRFESVFPRPYGAILFCTVGVLLRKLEAGLRGVSHIIVDEIHERDVNSDFLLVI

Q22307|DHX9_CE         ETCGYNVRFDSATPRPYGSIMFCTVGVLLRMMENGLRGISHVIIDEIHERDVDTDFVLIV

                       .: **.***:*  ***:.:*:********* :* *:**:**:*:*******:::**:*::

 

Q08211|DHX9_HS         LRDVVQAYPEVRIVLMSATIDTSMFCEYFFNCP------IIEVYGRTYPVQEYFLEDCIQ

Q28141|DHX9_BOVIN      LRDVVQAYPEVRIVLMSATIDTSMFCEYFFNCP------IIEVYGRTFPVQEYFLEDCIQ

O70133|DHX9_MM         LRDVVLAYPEVRIVLMSATIDTTMFCEYFFNCP------IIEVYGRTFPVQEYFLEDCIQ

P24785|MLE_DM          LRDMVDTYPDLHVILMSATIDTTKFSKYFGICP------VLEVPGRAFPVQQFFLEDIIQ

Q22307|DHX9_CE         LREMISTYRDLRVVLMSATIDTDLFTNFFSSIPDVGPTPVITMHGRTFPVQSFYLEDILH

                       **::: :* :::::********  * ::*   *      :: : **::***.::*** ::

 

Q08211|DHX9_HS         MTHFVPPPKDKKKKDK------DDDG----GEDDD---ANCNLICGDEYGPETRLSMSQL

Q28141|DHX9_BOVIN      MTHFVPPPKDKKKKDK------DDDG----GEDDD---ANCNLICGDEYGAETRISMAQL

O70133|DHX9_MM         MTQFIPPPKDKKKKDK------EDDG----GEDDD---ANCNLICGDEYGPETKLSMSQL

P24785|MLE_DM          MTDFVPSAESRRKRKE------VEDEEQLLSEDKDEAEINYNKVCEDKYSQKTRNAMAML

Q22307|DHX9_CE         NLQHMPEEPDQKKRKKGGPPPPDDDEG---DEEVDDKGRNMNILTDPSINESLKTAMSRI

                         ..:*   .::*:.:       :*     .*: *    * * :   . . . : :*: :

 

Q08211|DHX9_HS         NEKETPFELIEALLKYIETLNVPGAVLVFLPGWNLIYTMQKHLEMNPHFG-SHRYQILPL

Q28141|DHX9_BOVIN      NEKETPFELIEALLLYIETLNVPGAVLVFLPGWNLIYTMQKHLEMNPHFG-SHRYQILPL

O70133|DHX9_MM         NEKETPFELIEALLKYIETLNVPGAVLVFLPGWNLIYTMQKHLENNSHFG-SHRYQILPL

P24785|MLE_DM          SESDVSFELLEALLMHIKSKNIPGAILVFLPGWNLIFALMKFLQNTNIFGDTSQYQILPC

Q22307|DHX9_CE         SEKDIPFGVIEAILNDIASRGVDGAVLVFLPGWAEIMTLCNRLLEHQEFGQANKYEILPL

                       .*.: .* ::**:*  * : .: **:*******  * :: : *     ** : :*:***

 

Q08211|DHX9_HS         HSQIPREEQRKVFDPVPVGVTKVILSTNIAETSITINDVVYVIDSCKQKVKLFTAHNNMT

Q28141|DHX9_BOVIN      HSQIPREEQRKVFDPVPSGVTKIILSTNIAETSITINDVVYVIDSCKQKVKLFTAHNNMT

O70133|DHX9_MM         HSQIPREEQRKVFDPVPDGVTKVILSTNIAETSITINDVVYVIDSCKQKVKLFTAHNNMT

P24785|MLE_DM          HSQIPRDEQRKVFEPVPEGVTKIILSTNIAETSITIDDIVFVIDICKARMKLFTSHNNLT

Q22307|DHX9_CE         HSQLTSQEQRKVFNHYP-GKRKIIVSTNIAETSITIDDVVYVIDSCKAKERMYTSNNNMV

                       ***:. :******:  * *  *:*:***********:*:*:*** ** : :::*::**:.

 

Q08211|DHX9_HS         NYATVWASKTNLEQRKGRAGRVRPGFCFHLCSRARFERLETHMTPEMFRTPLHEIALSIK

Q28141|DHX9_BOVIN      NYATVWASKTNLEQRKGRAGRVRPGFCFHLCSRARFERLETHMTPEMFRTPLHEIALSIK

O70133|DHX9_MM         NYATVWASKTNLEQRKGRAGRVRPGFCFHLCSRARFDRLETHMTPEMFRTPLHEIALSIK

P24785|MLE_DM          SYATVWASKTNLEQRKGRAGRVRPGFCFTLCSRARFQALEDNLTPEMFRTPLHEMALTIK

Q22307|DHX9_CE         HFATVWASKTNVIQRRGRAGRVRAGYAFHLCSKMRFEALDDHGTAEMLRIPLHQIALTIK

                        :*********: **:*******.*:.* ***: **: *: : *.**:* ***::**:**

 

Q08211|DHX9_HS         LLRLGGIGQFLAKAIEPPPLDAVIEAEHTLRELDALDANDELTPLGRILAKLPIEPRFGK

Q28141|DHX9_BOVIN      LLRLGGIGQFLAKAIEPPPLDAVIEAEHTLRELDALDANDELTPLGRILAKLPIEPRFGK

O70133|DHX9_MM         LLRLGGIGQFLAKAIEPPPLDAIIEAEHTLRELDALDANDELTPLGRILAKLPIEPRFGK

P24785|MLE_DM          LLRLGSIHHFLSKALEPPPVDAVIEAEVLLREMRCLDANDELTPLGRLLARLPIEPRLGK

Q22307|DHX9_CE         LLRLGSVGEFLGKALQPPPYDMVVESEAVLQAMGALDRNLELTSLGKMLARMPIEPVIAK

                       *****.: .**.**::*** * ::*:*  *: : .** * ***.**::**::**** :.*

 

Q08211|DHX9_HS         MMIMGCIFYVGDAICTIA-AATCFPEPFI-NEG--KRLGYIHRNFAGNRFSDHVALLSVF

Q28141|DHX9_BOVIN      MMIMGCIFYVGDAICTIS-AATCFPEPFI-SEG--KRLGYIHRNFAGNRFSDHVALLSVF

O70133|DHX9_MM         MMIMGCIFYVGDAVCTIS-AATCFPEPFI-SEG--KRLGYIHRNFAGNRFSDHVALLSVF

P24785|MLE_DM          MMVLGAVFGCADLMAIMASYSSTFSEVFS-LDIGQRRLANHQKALSGTKCSDHVAMIVAS

Q22307|DHX9_CE         VLILGTALGAGSVMCDVA-SAMSFPTPFVPREKHHSRLSGTQRKFAGNKFSDHVAIVSVI

                       ::::*  :  .. :. ::  :  *.  *   :    **.  :: ::*.: *****:: .

 

Q08211|DHX9_HS         QAWDDARMGGE-EAEIRFCEHKRLNMATLRMTWEAKVQLKEILINSG-FPEDCLLTQVFT

Q28141|DHX9_BOVIN      QAWDDARMGGE-EAEIRFCEHKRLNMATLRMTWEAKVQLKEILINSG-FPEECLLTQVFT

O70133|DHX9_MM         QAWDDARMSGE-EAEIRFCEQKRLNMATLRMTWEAKVQLKEILINSG-FPEDCLLTQVFT

P24785|MLE_DM          QMWRREKQRGE-HMEARFCDWKGLQMSTMNVIWDAKQQLLDLLQQAG-FPEECMISHEVD

Q22307|DHX9_CE         QGYREAVQMGASAAEREFCERYSLSNPVLKMTDGARRQLIDVLRNQCSFPEDILFDISVN

                       * :      *    * .**:   *. ..:.:   *: ** ::* :   ***: ::   .

 

Q08211|DHX9_HS         N--TGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEGRNALIHKSSVNCPF-SSQDMK

Q28141|DHX9_BOVIN      N--TGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEGRNALIHKSSVNCPF-SSQDMK

O70133|DHX9_MM         N--TGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEGRNALIHKSSVNCPF-SSQDMK

P24785|MLE_DM          ERIDGDDPVLDVSLALLCLGLYPNICVHKEKRKVLTTESKAALLHKTSVNC---SNLAVT

Q22307|DHX9_CE         V--NGPDRELNLMRSLLVMALYPNVAYYVGKRKVLTIEQSSALINKYSMLVPMNNRQEMD

                           * *  *::  :** :.:***:. :  ***:** *   **::* *:     .   :

 

Q08211|DHX9_HS         YPSPFFVFGEKIRTRAISAKGMTLVTPLQLLLFASKKVQSDGQ-IVLVDDWIKLQISHEA

Q28141|DHX9_BOVIN      YPSPFFVFGEKIRTRAISAKGMTLVTPLQLLLFASKKVQSDGQ-LVLVDDWIRLQISHEA

O70133|DHX9_MM         YPSPFFVFGEKIRTRAISAKGMTLVTPLQLLLFASKKVQSDGQ-IVFIDDWIRLQISHEA

P24785|MLE_DM          FPYPFFVFGEKIRTRAVSCKQLSMVSPLQVILFGSRKIDLAANNIVRVDNWLNFDIEPEL

Q22307|DHX9_CE         FPSPLLVFTEKVRTRCISCKQMSVISAIQLLVFGSRKVECVGEGLVRIDETITIRMNVST

                       :* *::** **:***.:*.* :::::.:*:::*.*:*::  .: :* :*: : : :. .

 

Q08211|DHX9_HS         AACITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISRP-SAAGINLMIG----

Q28141|DHX9_BOVIN      AACITALRAAMEALVVEVTKQPGIISQLDPVNERMLNTIRQISRP-SAAGINLMIG----

O70133|DHX9_MM         AACIT-IRAAMEALVVEVSKQPNIISQLDPVNEHMLNTIRQISRP-SAAGINLMIG----

P24785|MLE_DM          AAKIGALKPALEDLITVACDNPSDILRLEEPYAQLVKVVKDLCVK-SAGDFGLQRESGIL

Q22307|DHX9_CE         AAALIGLRPCIEALLVKSCENPESLAGLNPSDAELRQLLRDISSEEFMSEAGPIKDS--L

                       ** :  ::..:* *:.   .:*  :  *:    .: : ::::.     .  .       

 

Q08211|DHX9_HS         ---STRYGDGPRPPKMARYDNG----SGYRR--GGSSYSGGGYG---GGYSSGGYG----

Q28141|DHX9_BOVIN      ---TTRYGDGPRPPKMARYDNG----SGYRR--GGSSYSGGGYGL--GGYGTGGYG----

O70133|DHX9_MM         ---SVRYGDGPRPPKMARYDNG----SGYRRGYGGGGYGGGGYG---GGYGSGGFGGGFG

P24785|MLE_DM          PHQSRQFSDGGGPPKRGRFETGRFTNSSFGRR-GNGRTFGGGYGNNGGGYGN--------

Q22307|DHX9_CE         LTDNALIQKGPAPNRLEYADWGP---SNNNSSFQNQDFPPAAGGKVHPYRGN--------

                          .    .*  * :    : *    *.      .     .. *      ..       

 

Q08211|DHX9_HS         ---------------------------------------------------SGG------

Q28141|DHX9_BOVIN      ---------------------------------------------------GGGGYGGRG

O70133|DHX9_MM         SGGGFGGGFNSGGGGFGSGGGGFGSGGGGFGGGGGGFSGGGGGGFGGGRGGGGGGFGGSG

P24785|MLE_DM          ---------------------------------------------------NGGGYGNIG

Q22307|DHX9_CE         ---------------------------------------------------RRGNHPYAQ

                                                                            *     

 

Q08211|DHX9_HS         -----------------------YGGSANSFR---AGYGAG-----------VGGG---Y

Q28141|DHX9_BOVIN      GYS-----------------GGGYGGGSNSFRGSYVGGGGG-----------VGGGGGGF

O70133|DHX9_MM         GFGNGGGGYGVGGGGYGGGGGGGYGGGSGGYGGGGYGGGEGYSISPNSYRGNYGGGGGGY

P24785|MLE_DM          G---------------------GYGNNAGGYG-----NNGG-----------YGNNGGGY

Q22307|DHX9_CE         NRP--------------------YAPPNSGMG-YQNFNNSG-----------YGASGDWN

                                              *.   ..        . *            * .   

 

Q08211|DHX9_HS         RGVSRGGFRGNSGGDYRGPSGG-YRGSGGFQRGGG---RGAYGTGYFGQGRGGGG---Y

Q28141|DHX9_BOVIN      RGLSRGGYRGMSGGDYRGESGGGYRGSGGFQRGGG---RGGYGGGYFGQGRGGGG---Y

O70133|DHX9_MM         RGGSQGGYRNNFGGDYRGSSGD-YRGSGGGYRGSGGFQRRGYGGGYFGQGRGGGGGGGY

P24785|MLE_DM          RNN--GGGYGNNGGGYGNKRGG-FGDSFESNRGSG----GGFRNGDQG-GRWGNF----

Q22307|DHX9_CE         AGR---GNYGNVGSGYRGAGGG------GGYRGGR----GGRGGGRGGGGRGWNASNW-

                        .    *  .  *..* .  *.         **.      .   *  * **  .