S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein CG1582 DHX57
DHX57
Database Links
Cellular Function

Group Alignment

Q6P158|DHX57_Hs.         MSSSVRRKGKPGKGGGKGSSRGGRGGRSHASKSHGSGGGGGG-GGGGGGGNRKASSRIWD

Q6P5D3|DHX57_Mm.         MSSSVRRKGKPGKGDGKGSSRGGRGGKGHMNKSHGGGGGGGGSCGGGGGGSRKASNRIWD

Q9VZ55|GH07148p_Dm.      MDESSRK---------------------------------------------HMEDCFLR

                         *..* *:                                             : .. : 

 

Q6P158|DHX57_Hs.         DGDDFCIFSESRRPSRPSNSNISKGESRPKWKPKAKVPLQTLHMTSENQEKVKALLRDLQ

Q6P5D3|DHX57_Mm.         DGDDFCVFTEPKRPSRPCDSNKSKGETRPKWKPKAKVPLQTLHMTSENQEKVKALLRDLQ

Q9VZ55|GH07148p_Dm.      SPSDIRTTNVPAAPKSQAADNKSR-----------KTELHVLRLNDESRQMTMDTLRQIH

                         . .*:   . .  *.  . .* *:           *. *:.*::..*.:: .   **:::

 

Q6P158|DHX57_Hs.         EQDADAGSERGLSGEEEDDEPDCCNDERYWPAGQEPSLVPDLDPLEYAGLASVEPYVPEF

Q6P5D3|DHX57_Mm.         EQGADAGSERGTSGEEEDSEPQCG-EEQGWPAGQEPIFLPDCSPWEYIGPEEVEPPVPEC

Q9VZ55|GH07148p_Dm.      GPEFQLDD---ISKYKDRGRGGHGVKHSYWQD-RGTLVVQSVQGVSSTRGNDSDGDR---

                             : ..    *  :: ..     ..  *   : . .: . .  .     . :     

 

Q6P158|DHX57_Hs.         TVSPFAVQKLSRYGFNTERCQAVLRMCDGDVGASLEHLLTQCFSETFGERMKISEAVNQI

Q6P5D3|DHX57_Mm.         AVSPLAVQKLSRYGFHTEHCQLALRICDGDLGAALEHLLRQCFSETFGERMALSEAAVYV

Q9VZ55|GH07148p_Dm.      -LRRYALAKLENYGFQAVHCLEAYEHCSGDTEAALLLLYRRYMRIPDEEQLTLEPP----

                          :   *: **..***:: :*  . . *.**  *:*  *  : :  .  *:: :. .   

 

Q6P158|DHX57_Hs.         SLDECMEQRQEEAFALKSICGEKFIERIQNRVWTIGLELEYLTSR-------------FR

Q6P5D3|DHX57_Mm.         SLNECVEQRQEETLALKSICGEKFIERIQNRVWTIGLELDYLTNK-------------FC

Q9VZ55|GH07148p_Dm.      SEQEILDMRADEKEALESIFDKAYEEREANRVWNLKFRIDHLLAHSPSEVRKAREAVLAA

                         * :* :: * :*  **:** .: : **  ****.: :.:::*  :              

 

Q6P158|DHX57_Hs.         KSKPKESTKNVQENSLEICK-FYLKGNCKFGSKCRFKHEVPPNQIVGRIERSVDDSHLNA

Q6P5D3|DHX57_Mm.         KSKQKESSKNVRDTSPETCK-FYLKGNCKFGSKCKFKHEVPPHQMIGRAERNVNDPHLDA

Q9VZ55|GH07148p_Dm.      AAAAAQAALDKKKKPPLRCRNFDRDGTCKYGPKCRFAHLPQQPTESDTTKKDSVD-----

                          :   ::: : :...   *: *  .*.**:*.**:* *        .  ::.  *    

 

Q6P158|DHX57_Hs.         IEDASFLYELEIRFSKDHKYPYQAPLVAFYSTNENLPLACRLHISEFLYDKALTFAETSE

Q6P5D3|DHX57_Mm.         DDDTTFMYELQIRFSKDHKYPYQAPLVAFYSTNENLPLACRLHISEFLYGKALEFAKTSE

Q9VZ55|GH07148p_Dm.      ENDNELWFHVEVRFPPGSRYPYEAPFIYLKTTCHDIPHELRLRYARHLYKEAKEICRDGI

                          :*  : :.:::**. . :***:**:: : :* .::*   **: :..** :*  :.. .

 

Q6P158|DHX57_Hs.         PVVYSLITLLEEESEIVKLLTNTHHKYSDPPVNFLPVPSRTRINNPACHKTVIPNNSFVS

Q6P5D3|DHX57_Mm.         PVVYSLITLLEEESEIVKLLTHTQHKYSVPPVNVPPVPSETRISKPAYRKPVVPSNTFLS

Q9VZ55|GH07148p_Dm.      PCVYSICDLLQSNEQLAGRLDTS----------AFPSPKRSLFYDEPAGGGVNPD-----

                         * ***:  **:.:.::.  *  :            * *..: : . .    * *.    

 

Q6P158|DHX57_Hs.         NQIPEVEKASESEE-SDEDDGPAPVIVENESYVNLKKKISKRYDWQAKSVHAENGKICKQ

Q6P5D3|DHX57_Mm.         NQMLEGERLSELEEDADEDEGPASIIVENESYVNLKKRSYKRYDRPAKSLFAENSKICRQ

Q9VZ55|GH07148p_Dm.      ---------------AEHHQSPKPSHYAR----GQTSRNDGGHQRNVEAQTRENRRLLQQ

                                        ::..:.* .    .    . ..:    ::  .::   ** :: :*

 

Q6P158|DHX57_Hs.         FRMKQASRQFQSILQERQSLPAWEERETILNLLRKHQVVVISGMTGCGKTTQIPQFILDD

Q6P5D3|DHX57_Mm.         FQMKQASRQFHAILQERQLLPAWEERETILKLLSKHQVVVISGMTGCGKTTQIPQFILDN

Q9VZ55|GH07148p_Dm.      FVERRKEERYQKIIDGRKQLPAFAEIERILALIESSPVVVISGETGCGKSTQVPQFILDN

                         *  :: ..::: *:: *: ***: * * ** *: .  ****** *****:**:******:

 

Q6P158|DHX57_Hs.         ----SLNGPPEK---VANIICTQPRRISAISVAERVAKERAERVGLTVGYQIRLESVKSS

Q6P5D3|DHX57_Mm.         ----SLNGPPER---VANIICTQPRRISAISVAERVAKERAERVGLTVGYQIRLESVKSS

Q9VZ55|GH07148p_Dm.      WFFRALQLPAKENLPHVEIICTQPRRLSAIGVAERVAAERLDRIGQLVGYQIRLENKVSQ

                             :*: *.:.    .:********:***.****** ** :*:*  ********.  *.

 

Q6P158|DHX57_Hs.         ATRLLYCTTGVLLRRLEGDTALQGVSHIIVDEVHERTEESDFLLLVLKDIVSQRPGLQVI

Q6P5D3|DHX57_Mm.         ATRLLYCTTGVLLRRLEGDATLQGVTHIIVDEVHERTEESDFLLLVLKDIVMQRATLQVI

Q9VZ55|GH07148p_Dm.      STRLSFCTTGILLRRLASDPLLGSVTHVIVDEVHERSEESDFLLLILKNLLRERKDLKVI

                         :*** :****:***** .*. * .*:*:********:********:**::: :*  *:**

 

Q6P158|DHX57_Hs.         LMSATLNAELFSDYFNSCPVITIPGRTFPVDQFFLEDAIAVTRYVLQDGSPYMRSMKQIS

Q6P5D3|DHX57_Mm.         LMSATLDAGLFSKYFSYCPVITIPGRAFPVDQFFLEDALAVTRYVLQDGSPYMRSMKQIA

Q9VZ55|GH07148p_Dm.      LMSATLNAALFSDYFGGAPVLDIPGRTFPVQQLFLEDILEMSDFVMEYDTKYCRKLKKQE

                         ******:* ***.**. .**: ****:***:*:**** : :: :*:: .: * *.:*: 

 

Q6P158|DHX57_Hs.         KEKLKARRNRTAFEEVEEDLRLSLHLQDQD-SVKDAVPDQQLDFKQLLARYKGVSKSVIK

Q6P5D3|DHX57_Mm.         KEKLKARHNRTAQEEVEEDLRLSLHLQDEEESVKDTIPDQQLDFKQLLIRYKGVSKSVIK

Q9VZ55|GH07148p_Dm.      QEILER-------ELEYADVQASGEAPGKK------IKDEKLTLAETYQRYAEYSKPTCK

                         :* *:        *    *:: * .  .:.      : *::* : :   **   **.. *

 

Q6P158|DHX57_Hs.         TMSIMDFEKVNLELIEALLEWIVDGKHSYP-PGAILVFLPGLAEIKMLYEQLQSNSLFNN

Q6P5D3|DHX57_Mm.         TMSVMDFEKVNLELIEALLEWIVDGKHAYP-PGAVLVFLPGLAEIKMLYEQLQSNSLFNN

Q9VZ55|GH07148p_Dm.      SIYLMEPMTINPELIESVLKYIVEGSHDWPREGTILIFLPGFGEIQSVHDSLLDNALFSP

                         :: :*:  .:* ****::*::**:*.* :*  *::*:****:.**: :::.* .*:**.

 

Q6P158|DHX57_Hs.         RRSNRCVIHPLHSSLSSEEQQAVFVKPPAGVTKIIISTNIAETSITIDDVVYVIDSGKMK

Q6P5D3|DHX57_Mm.         RRSHRCVIHPLHSSLSSEEQQAVFVKPPMGVTKIIISTNIAETSITIDDVVYVIDSGKMK

Q9VZ55|GH07148p_Dm.      R-AGKFILVPLHSALSGEDQALVFKKAPPGKRKIVLSTNIAETSVTIDDCVFVVDCGLMK

                         * : : :: ****:**.*:*  ** *.* *  **::********:**** *:*:*.* **

 

Q6P158|DHX57_Hs.         EKRYDASKGMESLEDTFVSQANALQRKGRAGRVASGVCFHLFTSHHYNHQLLKQQLPEIQ

Q6P5D3|DHX57_Mm.         EKRYDAGKGMESLEDTFVSQANALQRKGRAGRVASGVCFHLFTSHHYNHQLLKQQLPEIQ

Q9VZ55|GH07148p_Dm.      EKCFDSNRNMESLDLVWVSRANAKQRKGRAGRVMPGVCIHLYTSYRYQYHILAQPVPEIQ

                         ** :*:.:.****: .:**:*** ********* .***:**:**::*::::* * :****

 

Q6P158|DHX57_Hs.         RVPLEQLCLRIKILEMFSAHNLQSVFSRLIEPPHTDSLRASKIRLRDLGALTPDERLTPL

Q6P5D3|DHX57_Mm.         RVPLEQLCLRIKILEMFSTHNLQSVFSRLIEPPHIDSLRASKVRLRDLGALTPDEKLTPL

Q9VZ55|GH07148p_Dm.      RVPLEQIVLRIKTLQTFASRNTLSVLLETLEAPTEDSVLGALTRLRDVGALDAEDQLTPL

                         ******: **** *: *:::*  **: . :*.*  **: .:  ****:*** .:::****

 

Q6P158|DHX57_Hs.         GYHLASLPVDVRIGKLMLFGSIFRCLDPALTIAASLAFKSPFVSPWDKKEEANQKKLEFA

Q6P5D3|DHX57_Mm.         GYHLASLPVDVRIGKLMLLGSIFRCLDPALTIAASLAFKSPFVSPWDKKEEANQKKLEFA

Q9VZ55|GH07148p_Dm.      GHHLAALPVDVRIGKLMLYGAIFQCLDSVLTIAACLSNKSPFVSPLNKRTEADKCKRMFA

                         *:***:************ *:**:***..*****.*: ******* :*: **:: *  **

 

Q6P158|DHX57_Hs.         FANSDYLALLQAYKGWQLSTKEG-VRASYNYCRQNFLSGRVLQEMASLKRQFTELLSDIG

Q6P5D3|DHX57_Mm.         FANSDYLALLCAYKGWQLSTKES-ARASYNYCRQNFLSGRTLQEMASLKRQFTELLSDIG

Q9VZ55|GH07148p_Dm.      LGNSDHLTVLNAYRKWLDVARRGNYAASRNYASEHFLSLNTLETIADLKYQYLELLVSIG

                         :.***:*::* **: *   ::..   ** **. ::*** ..*: :*.** *: *** .**

 

Q6P158|DHX57_Hs.         FAREGLRAREIEKRAQGGDGVLDATGEEANSNAENPKLISAMLCAALYPNVVQVKSPEGK

Q6P5D3|DHX57_Mm.         FVKEGLRAKEIEKRAQGGDGVLDATGEEANTNAENPKLISAVLCAALYPNVVQVKTPEGK

Q9VZ55|GH07148p_Dm.      FVPIDVPR----RRKNACDNILTLTGVEQNHNGDNNRLLTSLLCAALYPNIVKIMTPDRV

                         *.  .:      :* :. *.:*  ** * * *.:* :*::::********:*:: :*: 

 

Q6P158|DHX57_Hs.         FQKTSTGAVRMQPKSAELKFVTKNDGYVHIHPSSVNYQVRHFDSPYLLYHEKIKTSRVFI

Q6P5D3|DHX57_Mm.         FQKTSSGVVRLQPKSAELKFVTKNDGYVHIHPSSVNYQVRHFDSPYLLYHEKIKTSRVFI

Q9VZ55|GH07148p_Dm.      YIQTAGGAVPREPSHHDLRFKTRGDGYVKIHPSSVNSQVSVFQAPFLVFQEKVRTSAIYI

                         : :*: *.*  :*.  :*:* *:.****:******* **  *::*:*:::**::** ::*

 

Q6P158|DHX57_Hs.         RDCSMVSVYPLVLFGGGQVNVQLQRGEFVVSLDDGWIRFVAASHQVAELVKELRCELDQL

Q6P5D3|DHX57_Mm.         RDCSMVSVYPLVLFGGGQVNVQLQRGAFVVSLDDGWIRFVAASHQVAELVKELRCELDQL

Q9VZ55|GH07148p_Dm.      RDCSMLPLIAMVLFAGSDFKVELHDGDFLFLLESGWIILKAHDLETAEMVQCLRAEMIKL

                         *****:.: .:***.*.:.:*:*: * *:. *:.*** : * . :.**:*: **.*: :*

 

Q6P158|DHX57_Hs.         LQDKIKNPSIDLCTCPRGSRIISTIVKLVTTQ-

Q6P5D3|DHX57_Mm.         LQDKIKNPSMDLCSCPRGSRIISMIVKLITTQ-

Q9VZ55|GH07148p_Dm.      LEEKIRDPCLNLLHHKNGCRMIANIVHLISKNS

                         *::**::*.::*    .*.*:*: **:*::.: