S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein DHX40
DHX40
ARG147
Database Links
Cellular Function

Group Alignment

Q8IX18|DHX40_Hs      MSRFPAVAGRAPRRQEEGERSRDLQEERLSAVCIADREEKGCTSQEGGTTPTFPIQKQRK

Q6PE54|DHX40_Mm      MSRFPAVAGRAPRRQEEGERPIELQEERPSAVRIADREEKGCTSQEGGTTPTFPIQKQRK

                     ********************. :***** *** ***************************

 

Q8IX18|DHX40_Hs      KIIQAVRDNSFLIVTGNTGSGKTTQLPKYLYEAGFSQHGMIGVTQPRKVAAISVAQRVAE

Q6PE54|DHX40_Mm      KLIQAVRDNSFLIVTGNTGSGKTTQLPKYLYEAGFSQHGMIGVTQPRKVAAISVAQRVAE

                     *:**********************************************************

 

Q8IX18|DHX40_Hs      EMKCTLGSKVGYQVRFDDCSSKETAIKYMTDGCLLKHILGDPNLTKFSVIILDEAHERTL

Q6PE54|DHX40_Mm      EMKCTLGSKVGYQVRFDDCSSKETAIKYMTDGCLLKHILGDPNLSKFSVIILDEAHERTL

                     ********************************************:***************

 

Q8IX18|DHX40_Hs      TTDILFGLLKKLFQEKSPNRKEHLKVVVMSATMELAKLSAFFGNCPIFDIPGRLYPVREK

Q6PE54|DHX40_Mm      TTDILFGLLKKLFQDKSPNRKEHLKVVVMSATMELAKLSAFFGNCPIFDIPGRLYPVREK

                     **************:*********************************************

 

Q8IX18|DHX40_Hs      FCNLIGPRDRENTAYIQAIVKVTMDIHLNEMAGDILVFLTGQFEIEKSCELLFQMAESVD

Q6PE54|DHX40_Mm      FCNLIGPRDRENTAYIQAIVKVTMDIHLNEMAGDILVFLTGQFEIEKSCELLFQMAESVD

                     ************************************************************

 

Q8IX18|DHX40_Hs      YDYDVQDTTLDGLLILPCYGSMTTDQQRRIFLPPPPGIRKCVISTNISATSLTIDGIRYV

Q6PE54|DHX40_Mm      YDYDVQDTTLDGLLILPCYGSMTTDQQRRIFLPPPPGIRKCVISTNISATSLTIDGIRYV

                     ************************************************************

 

Q8IX18|DHX40_Hs      VDGGFVKQLNHNPRLGLDILEVVPISKSEALQRSGRAGRTSSGKCFRIYSKDFWNQCMPD

Q6PE54|DHX40_Mm      VDGGFVKQLNHNPRLGLDILEVVPISKSEALQRSGRAGRTASGKCFRIYSKEFWSQCMPD

                     ****************************************:**********:**.*****

 

Q8IX18|DHX40_Hs      HVIPEIKRTSLTSVVLTLKCLAIHDVIRFPYLDPPNERLILEALKQLYQCDAIDRSGHVT

Q6PE54|DHX40_Mm      HVIPEIKRTSLTSVVLTLKCLAIHDVIRFPYLDPPNERLILEALKQLYQCDAIDRSGHVT

                     ************************************************************

 

Q8IX18|DHX40_Hs      RLGLSMVEFPLPPHLTCAVIKAASLDCEDLLLPIAAMLSVENVFIRPVDPEYQKEAEQRH

Q6PE54|DHX40_Mm      RLGLSMVEFPLPPHLTCAVIRAASLDCEDLLLPIAAMLSVENVFIRPVDPEYQKEAEQRH

                     ********************:***************************************

 

Q8IX18|DHX40_Hs      RELAAKAGGFNDFATLAVIFEQCKSSGAPASWCQKHWIHWRCLFSAFRVEAQLRELIRKL

Q6PE54|DHX40_Mm      RELAAKAGGFNDFATLAVIFEQCKSSGAPASWCQKHWIHWRCLFSAFRVEAQLRELIRKL

                     ************************************************************

 

Q8IX18|DHX40_Hs      KQQSDFPKETFEGPKHEVLRRCLCAGYFKNVARRSVGRTFCTMDGRGSPVHIHPSSALHE

Q6PE54|DHX40_Mm      KQQSDFPRETFEGPKHEVLRRCLCAGYFKNVARRSVGRTFCTMDGRGSPVHIHPSSALHE

                     *******:****************************************************

 

Q8IX18|DHX40_Hs      QETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHEFNAHDLSSVARREVREDAR

Q6PE54|DHX40_Mm      QETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRDLLPKLHELNAHDLSSVARREMREDAR

                     *****************************************:************:*****

 

Q8IX18|DHX40_Hs      RRWTNKENVKQLKDGISKDVLKKMQRRNDDKSISDARARFLERKQQRTQDHSDTRKETG

Q6PE54|DHX40_Mm      RKWTNKENVKQLKDGISKEVLKKMQRRNDDKSISDARARFLERKQQRIQDHSDTLKETG

                     *:****************:**************************** ****** ****