S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Dhr1p
YMR128W / ECM16
RHA2 KURZ
CG3228
DHX37
DHX37
Database Links
Cellular Function Ribosome Biogenesis

Group Alignment

Q8IY37|DHX37_Hs      MGKLRRRYNIKGRQ-----------------QAGPGPSKGPPEPPPVQLELEDKDTLKGV

Q6NZL1|DHX37_Mm      MGKLRRRYNVKGRL-----------------QADPRPAKGP-EAPPVRLELEGKDVLKGV

O46072|Kurz_Dm       MG--KKVHNAKARQ-----------------NPQTIVDNSAVKKIQIDVDAVAGGNQVGY

P34305|RHA2_Ce       MG-----------------------------KRKTKEDNASEDYDANELMIVPGEKRKKL

Q04217|DHR1_Sc       MGTYRKRFNEKARSGHMAKLKELKRIRNKQFTRQDENDERVENPDSAPAESSTTEPNANA

                     **                                    :   .                

 

Q8IY37|DHX37_Hs      DASNALVLPGKKKKKTKAPPLSKKEKKPLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEV

Q6NZL1|DHX37_Mm      DESNVLVLPGKRKKKTKAPPPSKKERKPLTKKERKVLQKVLEQKEKKSQRAELLQKLSEV

O46072|Kurz_Dm       DEANALVLPSE-KRATKIKVDKVQHVKILSKKQRKHLQAIVDKKKKKEGRAQLLGDLAAV

P34305|RHA2_Ce       EKSGEKSATGGKKNRNFAK---EKEVAKLTKQAKRKLAAVQSRKALKQTQEELFAGLAEF

Q04217|DHR1_Sc       EILEPLTEEEKKMKKRKLQELFTPKESKVSRLKKKRLDKFIEHQLKREERKTIIGKLQDY

                     :            .          .   :::  :: *  . .::  :. :  ::  *  

 

Q8IY37|DHX37_Hs      QASEAEMRLFYTTSKLGTG---------------------------------------NR

Q6NZL1|DHX37_Mm      QVSEAEMSLFYTTAKLGTG---------------------------------------DR

O46072|Kurz_Dm       QIPEEELQQYTSISQVQTVGLK------------------------------RLPTLDEY

P34305|RHA2_Ce       QLDPSKLCQLSSSTKLSKE-----------------------------------------

Q04217|DHR1_Sc       KIDTSLLTSSKRLGEGRQTKKEEFKEALSLERQGRGNEQTNEILYEEYEPKVWDEYGEGG

                     :     :       :                                            

 

Q8IY37|DHX37_Hs      MYHTKEK-ADEVVAPGQEKISSLSGAHRKR------------------------------

Q6NZL1|DHX37_Mm      MYHIKERKSGQPAARGQEKVSSLSGAHRKR------------------------------

O46072|Kurz_Dm       LAKKKERQAQVLAEKSSASGLRVNAIKGSK------------------------------

P34305|RHA2_Ce       ----PEKAPVFPEKLKVFSGKTKTEAKRTQ------------------------------

Q04217|DHR1_Sc       SSEDDDGEDDFEASFGSMPKPTDNEEKKSSGFIDHRPAKFGGSGLSFGFSNIKVINKESK

                          :                 .  : .                              

 

Q8IY37|DHX37_Hs      --------RRWPSAEEEEEEEEESESELEEESELDEDPAAEPAEAGVGTTVAPLPPAPAP

Q6NZL1|DHX37_Mm      --------HRSSSTEEDSESSEDSEPEEATADQPRTSTGTEPVHP---PPAPSGINSPAP

O46072|Kurz_Dm       --------RKLLVEEEEELQAKRKNPNVISVEEDDEDSSSSDEDDEEAPAQSAPIAIPTP

P34305|RHA2_Ce       --------QDYYPTDDESSSEEEEEEEEGDNDIEDAGNTVEVKIEPIDLDDVDEAIDGNP

Q04217|DHR1_Sc       TPKKKYNWRQRVEMEELKKHGKEDEMDFDTTSEDDDEEEDQEEEDKMHPSENPLEEVESA

                             :     :: .   : .: :    .        .                  .

 

Q8IY37|DHX37_Hs      SSQPVPA----------------------------------------GMTVPP-PPAAAP

Q6NZL1|DHX37_Mm      TPQPPPS----------------------------------------GISAPPKTPASAP

O46072|Kurz_Dm       VSIAPPQ----------------------------------------IAVKPPIKKLKPE

P34305|RHA2_Ce       ETNLDQI----------------------------------------VVKREDDEESDNE

Q04217|DHR1_Sc       DSETGSEKFDQNDVANEFKDWANQEIKKLEGRDQELVTPTLNIDYKPIIRKEDLDDGLQE

                      .                                                         

 

Q8IY37|DHX37_Hs      ---PLPRALAKPAVFIPVNRSPEMQEERLKLPILSEEQVIMEAVAEHPIVIVCGETGSGK

Q6NZL1|DHX37_Mm      ---PPP--VAKPAVFIPVNRTPEMQEERLKLPILAEEQAIMEAVAEHPIVIVCGETGSGK

O46072|Kurz_Dm       ---PNPPACIHQTVYVPVHRTTEVQNARLRLPILAEEQQVMETINENPIVIVAGETGSGK

P34305|RHA2_Ce       DILALPTTTVINRKKVIVERSKEIQKSRAELPIFAEEMRIVEAINENLVTVVCGETGSGK

Q04217|DHR1_Sc       AYVPINENSTRKAFYVEVSRSDEIQKARIQLPVFGEEHKIMEAIHHNDVVIICGETGSGK

                        .           : * *: *:*: * .**::.**  ::*:: .: :.::.*******

 

Q8IY37|DHX37_Hs      TTQVPQFLYEAGFSSEDS-----IIGVTEPRRVAAVAMSQRVAKEMNLSQRVVSYQIRYE

Q6NZL1|DHX37_Mm      TTQVPQFLYEAGYSSEDS-----IIGVTEPRRVAAVAMSQRVAKEMNLSHRVVSYQIRYE

O46072|Kurz_Dm       TTQLPQFLYEAGY-AQHK-----MIGVTEPRRVAAIAMSKRVAHEMNLPESEVSYLIRFE

P34305|RHA2_Ce       TTQIPQFLYEAGYASEGE-----LIGITEPRRVAAIAMAQRVGVELAKPD-EVSYQIRYE

Q04217|DHR1_Sc       TTQVPQFLYEAGFGAEDSPDYPGMVGITQPRRVAAVSMAERVANELGDHGHKVGYQIRFD

                     ***:********: :: .     ::*:*:******::*::**. *:      *.* **::

 

Q8IY37|DHX37_Hs      GNVTEETRIKFMTDGVLLKEIQKDFLLLRYKVVIIDEAHERSVYTDILIGLLSRIVTLRA

Q6NZL1|DHX37_Mm      GNVTEETRIKFMTDGVLLKEIQKDFLLLKYKVVIIDEAHERSVYTDILLGLLSRIVALRA

O46072|Kurz_Dm       GNVTPATRIKFMTDGVLLKEIETDFLLSKYSVIILDEAHERSVYTDILVGLLSRIVPLRH

P34305|RHA2_Ce       GTRSETTNILFMTDGVLMKEMEQDVMLKKYSVILIDEAHERSMYSDVLIGMLSRIVPLRS

Q04217|DHR1_Sc       STAKEDTKVKFMTDGVLLREMMHDFKLTKYSSIIIDEAHERNINTDILIGMLSRCVRLRA

                     .. .  *.: *******::*:  *. * :*. :::******.: :*:*:*:*** * **

 

Q8IY37|DHX37_Hs      KRNLP-------LKLLIMSATLRVEDFTQNPRLFAKPPPVIKVESRQFPVTVHFNKRTPL

Q6NZL1|DHX37_Mm      KRHLP-------LKLLIMSATLRVEDFTQNQRLFTTPPPVIKVESRQFPVTVHFNKRTPL

O46072|Kurz_Dm       KRGQP-------LKLIIMSATLRVSDFTENTRLFKIPPPLLKVEARQFPVTIHFQKRTP-

P34305|RHA2_Ce       KTARP-------LRLVIMSATLRLDDFTHKKLFPLLTPKVIKVDARQFPVSVHFEKRTP-

Q04217|DHR1_Sc       KLHKENPIEHKKLKLIIMSATLRVSDFSENKTLFPIAPPVLQVDARQFPVSIHFNRRTA-

                     *           *:*:*******:.**:.:  :   .* :::*::*****::**::**.

 

Q8IY37|DHX37_Hs      EDYSGECFRKVCKIHRMLPAGGILVFLTGQAEVHALCRRLRKAFPPSRA-----------

Q6NZL1|DHX37_Mm      DDYSGECFRKVCKIHRMLPAGGILVFLTGQAEVHALCRRLRKAFPFRCS-----------

O46072|Kurz_Dm       DDYVAEAYRKTLKIHNKLPEGGILIFVTGQQEVNQLVRKLRRTFPYHHAPTKDVAKNGKV

P34305|RHA2_Ce       DDYIASAFRKTCRIHETLPPGAILVFVTGQHEVKQLITKLKKRYP---------------

Q04217|DHR1_Sc       FNYTDEAFRKTCKIHQKLPPGAILVFLTGQQEITHMVKRLRKEFPFKKN-----------

                      :*  ..:**. :**. ** *.**:*:*** *:  :  :*:: :*              

 

Q8IY37|DHX37_Hs      ---RPQEKDDDQKDSVEEMR----KFKKSRARAKKAR-----AEVLPQINLDHYSVLP-A

Q6NZL1|DHX37_Mm      ---QPQEKEED---SAEGMR----RFKKSRTRARKAQ-----AMALPQINLDNYSVLP-A

O46072|Kurz_Dm       SEEEKEETIDDAASTVEDPKELEFDMKRVIRNIRKSKKKFLAQMALPKINLDDYKLPGDD

P34305|RHA2_Ce       ---VVYETDKNGEVLVKGTKEWKEKKVEAAKSIKLEDFKEETPETEDFEDVDDGLMDG-D

Q04217|DHR1_Sc       -----SKYNKDLETPVSKMG------INSKTTDLEAEDIDFSVQVIDQDKFKSAIRYEED

                           :  .:    ..          .                .    ...       

 

Q8IY37|DHX37_Hs      GEGDEDREAEVDEEEGALDSDLDLDLGDGGQDGGEQPDASLPLHVLPLYSLLAPEKQAQV

Q6NZL1|DHX37_Mm      GEGDEDREAEMDDEEEALGSDLDLDLGDSEANEGEQPDASLPLHVLPLYSLLAPEKQAQV

O46072|Kurz_Dm       TEADMHEQPDEDDEQEGLEEDNDDELG-LEDESGMGSGQRQPLWVLPLYSLLSSEKQNRI

P34305|RHA2_Ce       DMNERGAAEAFDDYEEFENGDGDLSDGKVENSIGAPPADCEPLYCLPLYSLLSMGKQRRV

Q04217|DHR1_Sc       EGNSGNGEDEEDEEEEG-----------FEEVLTEGQTANDPLYVLPLYSLLPTKEQMRV

                        .       *: :                          **  *******.  :* ::

 

Q8IY37|DHX37_Hs      FKPPPEGTRLCVVATNVAETSLTIPGIKYVVDCGKVKKRYYDRVTGVSSFRVTWVSQASA

Q6NZL1|DHX37_Mm      FKPPPEGTRLCVVATNVAETSLTIPGIKYVVDCGKVKKRYYDRVTGVSSFRVTWVSQASA

O46072|Kurz_Dm       FLPVPDGCRLCVVSTNVAETSLTIPHIKYVVDCGRQKTRLYDKLTGVSAFVVTYTSKASA

P34305|RHA2_Ce       FDETPAGMRLCVISTNVAETSLTIPGVKYVIDGGFEKRRLYDSITGVSRFAVCRISQASG

Q04217|DHR1_Sc       FQKPPQGSRLCIVATNVAETSLTIPGVRYVVDSGRSKERKYNESNGVQSFEVGWVSKASA

                     *   * * ***:::*********** ::**:* *  * * *:  .**. * *   *:**.

 

Q8IY37|DHX37_Hs      DQRAGRAGRTEPGHCYRLYSSAVFGD-FEQFPPPEITRRPVEDLILQMKALNVEKVINFP

Q6NZL1|DHX37_Mm      DQRAGRAGRTEPGHCYRLYSSAVFGD-FEQFPPPEITRRPVEDLILQMKALSIEKVINFP

O46072|Kurz_Dm       DQRAGRAGRISAGHCYRLYSSAVYNDCFEDFSQPDIQKKPVEDLMLQMRCMGIDRVVHFP

P34305|RHA2_Ce       DQRAGRAGRISAGHAYRLYSSAVYQD-FVKFADPEILSKPADQLVLHLKSMNIVKVVNFP

Q04217|DHR1_Sc       NQRSGRAGRTGPGHCYRLYSSAVFEHDFEQFSKPEILRMPVESIVLQMKSMAIHNIINFP

                     :**:*****  .**.********: . * .*. *:*   *.:.::*:::.: : .:::**

 

Q8IY37|DHX37_Hs      FPTPPSVEALLAAEELLIALGALQPPQKAERVKQLQENRLSCPITALGRTMATFPVAPRY

Q6NZL1|DHX37_Mm      FPTPPSVEALVAAEELLVALGALQAPPKQERMKKLQMSQLSCPITALGRTMSTFPVAPRY

O46072|Kurz_Dm       FPSPPDQVQLQAAERRLIVLGALEVAKTEN-------TDLPPAVTRLGHVISRFPVAPRF

P34305|RHA2_Ce       FPSAPDEQMLESAEKRLCRLGALSESTKNG--------KTEARITKLGKTLAVFPLAPSY

Q04217|DHR1_Sc       FPTPPDRVALSKAIQLLQYLGALDN---------------KEMITEDGKKMSLFPLSPRF

                     **:.*.   *  * . *  ****.                   :*  *: :: **::* :

 

Q8IY37|DHX37_Hs      AKMLALSRQHGCLPYAITIVASMTVRELFEELDRPAASDEELTRLKSKRARVAQMKRTWA

Q6NZL1|DHX37_Mm      AKMLALSQQHGCLPYTIAIVAAMTVRELFEELDRPAASEKELAELKGRRARVAQMKRTWA

O46072|Kurz_Dm       GKMLALSHQQNLLPYTVCLVAALSVQEVLIETG--VQRDEDVAPGAN---RFHRKRQSWA

P34305|RHA2_Ce       AKFIAMADQHNLMSHAILLISLLSVREPLIPVS--SLRGDTPEETKELMKNVLKERRRWC

Q04217|DHR1_Sc       SKMLLVSDEKACLPYIVAIVSALSVGDPFINEFELGINEISRKPNPDENLDDKIREHDES

                     .*:: :: ::  :.: : ::: ::* : :                          .:  .

 

Q8IY37|DHX37_Hs      GQGASLKLGDLMVLLGAVGACEYASCT---PQFCEANGLRYKAMMEIRRLRGQLTTAVNA

Q6NZL1|DHX37_Mm      GQGPSLKLGDLMVLLGAVGACEYAGCS---PQFCQANGLRYKAMLEIRRLRGQLTTAVNA

O46072|Kurz_Dm       ASGNYQLLGDPMVLLRAVGAAEYAGSQGRLPEFCAANGLRQKAMSEVRKLRVQLTNEINL

P34305|RHA2_Ce       SHTGARRLGDLKVLMHAASVAEQIKYN---ARECEKVGLRVKALVEARKLRQQLTNIVNA

Q04217|DHR1_Sc       TPGMDPELKKELRSKFYKSRSQFSKLD---------------KFSDVFRLLSVVSAMDYV

                            * .        . .:                     : :  :*   ::    

 

Q8IY37|DHX37_Hs      VCP-EAELFVDPKMQPPTESQVTYLRQIVTAGLGDHLARRVQSEEMLED----KWRNAYK

Q6NZL1|DHX37_Mm      VCP-EAGLFLDPKMQPPTESQVTYLRQIMAAGLGDHLARRVQSEDLLDP----KWKNAYK

O46072|Kurz_Dm       NVS-DVELGVDPELKPPTDAQARFLRQILLAGMGDRVARKVPLADIADKEERRRLKYAYN

P34305|RHA2_Ce       SCKKEHAAALDSDLPPPTDQQAQLLRQMVVASFSDRLARRVDRSVGQEE----VQKGAYE

Q04217|DHR1_Sc       PKEQKEIFMKKNFLRGKLMEEIVKLRKQLMYIIKSNTSKENIAVVIRNE-----------

                         .     .  :      :   **: :   : .. ::.       :           

 

Q8IY37|DHX37_Hs      TPLLDDPVFIHPSSVLFKELPEFVVYQEIVET-----TKMYMKGVSSVEVQWIPALLPSY

Q6NZL1|DHX37_Mm      TPLLDDPVFIHPSSVLFKELPEFVVYQEIVET-----TKMYMKGVSTVEIQWIPSLLPSY

O46072|Kurz_Dm       CADMEEPAFLHVSSVLRQKAPEWVIYQEAYELQNGDSTKMFIRGITAIEPEWLLLYVPLL

P34305|RHA2_Ce       TTLIKGHVFIDPCSVVFTEEPEFVIYQELVQVN----EKKLMTSVCAVDKEWLSRLAESY

Q04217|DHR1_Sc       DLKSDIPSVIQIKLLKQMICAGFVDHVAVRADVLFPDDAKITNRTSIINIPYIPVLATRT

                         .   .:.   :     . :* :                     ::  ::      

 

Q8IY37|DHX37_Hs      CQFDKPLEEPAPTYCPERGRVLCHRASVFYRVGWPLPAIEVDFPEGIDRYKHFARFLLEG

Q6NZL1|DHX37_Mm      CQFDAPLEEPAPSYCPESGQVLCHRASVFYRVGWPLPAVQVDFPEGIDRYKYFAKFLLEG

O46072|Kurz_Dm       CNIREVREDPAPRFDKTSGKIFCHVDATFGKSGWELPLGEVEMPLSEKACCYFGMFLLDG

P34305|RHA2_Ce       CNYGEQDKNQEPIYDPVKDMVVKTVKVTFGPLNWELPNENRSVPHDIMMYRYFALFLLDG

Q04217|DHR1_Sc       PNIEDCFVYIHPTSILNNLGEMPPKYMLYYSLHLGGNNKTRMNTLCDIASTPLANIARKG

                      :         *         .      :              .        :. :  .*

 

Q8IY37|DHX37_Hs      QVFRKLASYRSCLLSSPGTMLKTWARLQPRTESLLRALVAEKADCHEALLAAWKKNPKYL

Q6NZL1|DHX37_Mm      QVFRKLASFKSCLLSSPSTMLKTWARLQPRTETLLRALVAHKADSRDSLLAAWKKNPKYL

O46072|Kurz_Dm       EVCSRLADFRSKLKSTPASVIKSWSSMNNKVLRFKRALITKQIHNRQALIDQWNSDPHFL

P34305|RHA2_Ce       LVFEKLKEYTPKLLAPPSTMVKSWAKLQKRTEMLLNKLIEKEVTTRSSLKEQWLKNENWL

Q04217|DHR1_Sc       LLLTYSKPLTGQGLKTVN---------LSPTERYCYVVPRFGSTVDNDLKIGWDLNPIAV

                      :             .              .      :        . *   *  :   :

 

Q8IY37|DHX37_Hs      LAEYCEWLPQAMHPDIEKAWPPTTVH------------

Q6NZL1|DHX37_Mm      LAEYCEWLPKAMHSDVEKNWPPTTDS------------

O46072|Kurz_Dm       LEEYQNLLYDVALSELTPLWPPVDKKEPQRQ-------

P34305|RHA2_Ce       LEEYLEWVPESVHQQISLMWPPLEDHEKTIKMGRNKKY

Q04217|DHR1_Sc       HQKKQKGQWTVIKFITRKGFQTITGEEKEKK-------

                       :  :             : .