S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein DHX36
DHX36
RHAU
Database Links
Cellular Function RNA decay

Group Alignment

Q9H2U1|DHX36_Hs.         MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGR

B2RQS6|DHX36_Mm.         MSYDYHQSWSRDGGPRGSG----QGSSGGGGGSRGSGGG----GGGRGGRGRHPAHLKGR

                         *******.*.******.**     *.:** **.******    ***********.*****

 

Q9H2U1|DHX36_Hs.         EIGMWYAKKQGQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKESEAQISWFAPE

B2RQS6|DHX36_Mm.         EIGLWYAKKQTQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKTDKDSEAQISWFAPE

                         ***:****** **********************************.**:***********

 

Q9H2U1|DHX36_Hs.         DHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGTL

B2RQS6|DHX36_Mm.         DHGYGTEVSSEKKINSEKKLDNQEKKLLNQEKKTFRITDKSYIDRDTEYLLQENEPNLSL

                         *********:::.  **:*** *****:***** *** ::******:*********: :*

 

Q9H2U1|DHX36_Hs.         DQKLLEDLQKKKNDLRYIEMQHFREKLPSYGMQKELVNLIDNHQVTVISGETGCGKTTQV

B2RQS6|DHX36_Mm.         DQHLLEDLQRKKTDPRYIEMQRFRKKLPSYGMQKELVNLINNHQVTVISGETGCGKTTQV

                         **:******:**.* ******:**:***************:*******************

 

Q9H2U1|DHX36_Hs.         TQFILDNYIERGKGSACRIVCTQPRRISAISVAERVAAERAESCGSGNSTGYQIRLQSRL

B2RQS6|DHX36_Mm.         TQFILDNYIERGKGSACRIVCTQPRRISAISVAERVATERAESCGNGNSTGYQIRLQSRL

                         *************************************:*******.**************

 

Q9H2U1|DHX36_Hs.         PRKQGSILYCTTGIILQWLQSDPYLSSVSHIVLDEIHERNLQSDVLMTVVKDLLNFRSDL

B2RQS6|DHX36_Mm.         PRKQGSILYCTTGIILQWLQSDSRLSSVSHIVLDEIHERNLQSDVLMTVIKDLLHFRSDL

                         **********************. *************************:****:*****

 

Q9H2U1|DHX36_Hs.         KVILMSATLNAEKFSEYFGNCPMIHIPGFTFPVVEYLLEDVIEKIRYVPEQKEHRCQFKR

B2RQS6|DHX36_Mm.         KVILMSATLNAEKFSEYFGNCPMIHIPGFTFPVVEYLLEDIIEKIRYVPDQKEHRSQFKR

                         ****************************************:********:*****.****

 

Q9H2U1|DHX36_Hs.         GFMQGHVNRQEKEEKEAIYKERWPDYVRELRRRYSASTVDVIEMMEDDKVDLNLIVALIR

B2RQS6|DHX36_Mm.         GFMQGHVNRQEKEEKEAIYKERWPAYIKELRTRYSASTVDVLQMMDDDKVDLNLIAALIR

                         ************************ *::*** *********::**:*********.****

 

Q9H2U1|DHX36_Hs.         YIVLEEEDGAILVFLPGWDNISTLHDLLMSQVMFKSDKFLIIPLHSLMPTVNQTQVFKRT

B2RQS6|DHX36_Mm.         YIVLEEEDGAILVFLPGWDNISTLHDLLMSQVMFKSDKFLIIPLHSLMPTVNQTQVFKKT

                         **********************************************************:*

 

Q9H2U1|DHX36_Hs.         PPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRK

B2RQS6|DHX36_Mm.         PPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETHFDTQNNISTMSAEWVSKANAKQRK

                         ************************************************************

 

Q9H2U1|DHX36_Hs.         GRAGRVQPGHCYHLYNGLRASLLDDYQLPEILRTPLEELCLQIKILRLGGIAYFLSRLMD

B2RQS6|DHX36_Mm.         GRAGRVQPGHCYHLYNGLRASLLDDYQLPEILRTPLEELCLQIKILRLGGIAYFLSRLMD

                         ************************************************************

 

Q9H2U1|DHX36_Hs.         PPSNEAVLLSIRHLMELNALDKQEELTPLGVHLARLPVEPHIGKMILFGALFCCLDPVLT

B2RQS6|DHX36_Mm.         PPSNEAVVLSIKHLMELSALDKQEELTPLGVHLARLPVEPHIGKMILFGALFCCLDPVLT

                         *******:***:*****.******************************************

 

Q9H2U1|DHX36_Hs.         IAASLSFKDPFVIPLGKEKIADARRKELAKDTRSDHLTVVNAFEGWEEARRRGFRYEKDY

B2RQS6|DHX36_Mm.         IAASLSFKDPFVIPLGKEKIADARRKELAKETRSDHLTVVNAFEGWEEAKRRGFRYEKDY

                         ******************************:******************:**********

 

Q9H2U1|DHX36_Hs.         CWEYFLSSNTLQMLHNMKGQFAEHLLGAGFVSSRNPKDPESNINSDNEKIIKAVICAGLY

B2RQS6|DHX36_Mm.         CWEYFLSSNTLQMLHNMKGQFAEHLLGAGFVSSRSPKDPKANINSDNEKIIKAVICAGLY

                         **********************************.****::*******************

 

Q9H2U1|DHX36_Hs.         PKVAKIRLNLGKKRKMVKVYTKTDGLVAVHPKSVNVEQTDFHYNWLIYHLKMRTSSIYLY

B2RQS6|DHX36_Mm.         PKVAKIRLNLGKKRKMVKVHTKSDGLVSIHPKSVNVEQTDFHYNWLIYHLKMRTSSIYLY

                         *******************:**:****::*******************************

 

Q9H2U1|DHX36_Hs.         DCTEVSPYCLLFFGGDISIQKDNDQETIAVDEWIVFQSPARIAHLVKELRKELDILLQEK

B2RQS6|DHX36_Mm.         DCTEVSPYCLLFFGGDISIQKDKDQEIIAVDEWIVFQSPERIAHLVKGLRKELDSLLQEK

                         **********************:*** ************ ******* ****** *****

 

Q9H2U1|DHX36_Hs.         IESPHPVDWNDTKSRDCAVLSAIIDLIKTQEKATPRNFPPRFQDGYYS

B2RQS6|DHX36_Mm.         IESPHPVDWDDTKSRDCAVLSAILDLIKTQEKATPRNLPPRSQDGYYS

                         *********:*************:*************:*** ******