S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein DHX35 CG3225 DHX35 DHX35
Database Links
Cellular Function

Group Alignment

A2ACQ1|DHX35_Mm      MAAPLG------PVK-------FWKPG--TEGP--GVSISEERQSVTENSGTT-------

Q9H5Z1|DHX35_Hs      MAAPVG------PVK-------FWRPG--TEGP--GVSISEERQSLAENSGTT-------

Q9BKQ8|DHX35_Ce      MSYHPGHGHRQEPRKGAGARRGFARPDDSADAPRTGPLIFEERS--TENAGAAPPIEEQL

Q9VR29|DHX35_Dm      MSTFKP---------------KFLKPET-------DDAITDSAG--GEQQSSA-------

                     *:                    * :*         .  * :.     *: .::      

 

A2ACQ1|DHX35_Mm      -IIYNPYAALSIEQQRQKLPVFKLRNHILYLVENYQTVVIVGETGCGKSTQIPQYLAEAG

Q9H5Z1|DHX35_Hs      -VVYNPYAALSIEQQRQKLPVFKLRNHILYLIENYQTVVIVGETGCGKSTQIPQYLAEAG

Q9BKQ8|DHX35_Ce      KVHNNPYASLNIQQQRIRLPIFKNRGHILYMCERYRTIIIVGETGCGKSTQVPQFLLEAG

Q9VR29|DHX35_Dm      -FVFNVNHNMGLMEQRERLPIRQYRDQILYCLEKHQVVILVGETGSGKSTQVPQYLYEWG

                      .  *    :.: :** :**: : *.:***  *.::.:::*****.*****:**:* * *

 

A2ACQ1|DHX35_Mm      WTAEGRVVGVTQPRRVAAVTVAGRVADERGAVLGHEVGYCIRFDDCTDPLATRIKFLTDG

Q9H5Z1|DHX35_Hs      WTAEGRVVGVTQPRRVAAVTVAGRVAEERGAVLGHEVGYCIRFDDCTDQLATRIKFLTDG

Q9BKQ8|DHX35_Ce      WAADGRQIVITQPRRVAVVTLATRVAEEKDCILGHDVGYTVRFDDVSD-KDTKVKFMTDG

Q9VR29|DHX35_Dm      WHTKG-LIGITEPRRVSTVTLANRVAQERGELVGDTVGYVVRFLESMS-SCTKIKFMTEG

                     * :.*  : :*:****:.**:* ***:*:. ::*. *** :** :  .   *::**:*:*

 

A2ACQ1|DHX35_Mm      MLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKRGDLRLIVASATLDAEK

Q9H5Z1|DHX35_Hs      MLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKRGDLRLIVASATLDADK

Q9BKQ8|DHX35_Ce      LLLREILADPLLSKYSIIMIDEAHERSCNTDILLGLLRKIIQIRNDLRIIVSSATLDAEL

Q9VR29|DHX35_Dm      ILLREVLADPLLTQYGVIIVDEAHERNMLTDMILGLLKKILRKRSSLKLIISSATIDASF

                     :*:**::.****::*.:*::******.  **: :***:** : *..*::*::***:**.

 

A2ACQ1|DHX35_Mm      FRDFFNQNETSDPARDTSVTLTVEGRTFPVDIFYLQSPVPDYIKATVDTVVKIHQTEGDG

Q9H5Z1|DHX35_Hs      FRDFFNQNETSDPARDTCVILTVEGRTFPVDIFYLQSPVPDYIKSTVETVVKIHQTEGDG

Q9BKQ8|DHX35_Ce      FKDFFEMNETGNSDKDTAGIISVEGRTHPVAVHHTKTSVPDYCQSAVDTVINIHKHENPG

Q9VR29|DHX35_Dm      FSEFFSWPGSG----EVSVKLSIEGRMHPVSNFYLNEPCADYVKETVETVWKLHQKEPPG

                     * :**.   :.    :..  :::*** .**  .: : . .** : :*:** ::*: *  *

 

A2ACQ1|DHX35_Mm      DILAFLTGQEEVETVVSMLIEQARALARTGMKKHLRVLPMYAGLPSFEQMKVFERVSHSV

Q9H5Z1|DHX35_Hs      DVLAFLTGQEEVETVVSMLIEQARALARTGMKRHLRVLPMYAGLPSFEQMKVFERVSRSV

Q9BKQ8|DHX35_Ce      DILVFLTGQDEVEDVCEKLRELAGNLKNC---DRLWVVPCYGALPAREQMKAFDSTPHGT

Q9VR29|DHX35_Dm      DILAFLTGQEEVLEALDLLREYIASSEQE----NLKVLPMYGSMSSTDQLSVFFTPPKGT

                     *:*.*****:**  . . * *      .     .* *:* *..:.: :*:..*   .:..

 

A2ACQ1|DHX35_Mm      RKVIVATNVAETSITISGIVYVIDCGFMKLRAYNPRTAIECLVVVPVSQASANQRAGRGG

Q9H5Z1|DHX35_Hs      RKVIVATNVAETSITISGIVYVIDCGFVKLRAYNPRTAIECLVVVPVSQASANQRAGRGG

Q9BKQ8|DHX35_Ce      RKVVVATNIAEASITIPGICYVIDTGYVKLRAQHAANGVETLMRVTVSKASAEQRAGRAG

Q9VR29|DHX35_Dm      RKVVLATNIAETSITIPGIVYVIDCGYVKVKWYNPKTCSDSLVIVPVSKASAIQRAGRAG

                     ***::***:**:****.** **** *::*::  :. .  : *: *.**:*** *****.*

 

A2ACQ1|DHX35_Mm      RNRSGKCYRLYTEEAFDQLPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQS

Q9H5Z1|DHX35_Hs      RSRSGKCYRLYTEEAFDKLPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQS

Q9BKQ8|DHX35_Ce      RIRPGKCYRLYPESEFERFAEGTVPEIQRCQMASTILQLKALGVQNVHRFHYLSPPPSWA

Q9VR29|DHX35_Dm      RMRPGKVYRLYTKSDYEALAPRQPPEMRRSELSGAILQLKALGIGNILRFDFPSPPPAQN

                     * *.** ****.:. :: :.    **::*.::: .********: *: **.: ****: 

 

A2ACQ1|DHX35_Mm      MVQALELLYALGGLDKDCRLTEPLGMRIAEFPLNPMFAKMLLESGNFGCSQEVLSIAAMM

Q9H5Z1|DHX35_Hs      MVQALELLYALGGLDKDCRLTEPLGMRIAEFPLNPMFAKMLLESGNFGCSQEILSIAAMM

Q9BKQ8|DHX35_Ce      MINGLELLYALGAIDETSQLTSPLGLQMAEFPLPPMHSKCLLKSAEFGCSTEMVTIVAMM

Q9VR29|DHX35_Dm      LLSALESLFALDAIDEQGNLTKPVGYLLAELPFSAMLSKMLYVSGQMGCSEEIITIIALL

                     ::..** *:**..:*:  .**.*:*  :**:*: .* :* *  *.::*** *:::* *::

 

A2ACQ1|DHX35_Mm      QIQNVFVFPSNQKSQ--ATRVHRKFAVEEGDHLTMLNVYEAFIKHNKSSQWCQEHFLNYK

Q9H5Z1|DHX35_Hs      QIQNIFVVPPNQKSH--AIRVHRKFAVEEGDHLTMLNIYEAFIKHNKDSKWCQEHFLNYK

Q9BKQ8|DHX35_Ce      QIQDVFITPYRQRHQ--ADVIRKKFAVEEGDHMTMLNVFTKFVENGRSKKWCSDHFVNYR

Q9VR29|DHX35_Dm      QVQSIFSRPASAVAQQSGRIAHRKFEVAEGDFITMLNAYTGFVEEGMTKEFCGQYFLIYR

                     *:*.:*  *     :  .   ::** * ***.:**** :  *::..  .::* ::*: *:

 

A2ACQ1|DHX35_Mm      GLVRAATVRDQLKKLL-VKFQVPKVSSEGDP---DPVLRCIVSGFFANAARFHSSGAYRT

Q9H5Z1|DHX35_Hs      GLVRAATVREQLKKLL-VKFQVPRKSSEGDP---DLVLRCIVSGFFANAARFHSTGAYRT

Q9BKQ8|DHX35_Ce      GLMRADNVRSQLVRLL-KRFEIEKVSSRGLINCSENIRQCLVTGFFSQAAQYHYTGKYMT

Q9VR29|DHX35_Dm      NLKRAHSLREQLITVARKKYGIPIFSCKGDV---EKLCKCITAGFFTQVAYLHHSGVYRQ

                     .* ** .:*.**  :   :: :   *..*     : : :*:.:***::.*  * :* * 

 

A2ACQ1|DHX35_Mm      IRDDHELHIHP-ASVLYAEKPPRWVIYNEVIQTSKYYMRDVTAIESAWLLELAPHFYQQG

Q9H5Z1|DHX35_Hs      IRDDHELHIHP-ASVLYAEKPPRWVIYNEVIQTSKYYMRDVTAIESAWLLELAPHFYQQG

Q9BKQ8|DHX35_Ce      VKESFPFNMYKGSSIMFKKDYPKWVIFTEVMQDS---IRDVTVIEPEWLYELAPHYYEFG

Q9VR29|DHX35_Dm      ISSGTELAIHP-NSTLYTLPQAQYVVYGELLQTTKLFMNYVTVIKREWLTELAPHYYQQT

                     : ..  : ::   * ::    .::*:: *::* :   :. **.*:  ** *****:*: 

 

A2ACQ1|DHX35_Mm      THLSLKAKRAKVQDQ---------

Q9H5Z1|DHX35_Hs      THLSLKAKRAKVQDP---------

Q9BKQ8|DHX35_Ce      TEGELAEKRMRGPAATSAAADDDY

Q9VR29|DHX35_Dm      TVRD--------------------

                     *  .