S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein smgl-2
Y37E11AM.1

CG32533 / mRpS14
DHX34
DHX34
Database Links
Cellular Function

Group Alignment

Q14147|DHX34_Hs       MPPPRTREGRDRRD--HHRAPSEEEALEKWDWNCPETRRLLEDAFFREEDYIRQGSEE-C

Q9DBV3|DHX34_Mm.      MPPPRTREGRGHRDRDHHRAPREEEAPEKWDWNCPETRCLLEDVFFRDEDYIRRGSEE-C

Q9VWI5|DHX34?_Dm      -------MSRIKKKADEHASSRRRTQINLIEFSFLDHKAELVGLLQAKSRQVGRSLVENE

Q9N437|smgl-2_Ce      ----MIFLNRERKG--ETNDHFDVNRVKFDDLGIPQDTGGLNRIRFKGEN----------

                              .* ::   .          :  : .  :    *       .          

 

Q14147|DHX34_Hs       QKFWTFFERLQRFQNLKTSRKEEKDPGQPKHSIPALADLPRTYDPRYRINLSVLGPATRG

Q9DBV3|DHX34_Mm.      QKFWAFFERLQRFQHLKTSQKKKKDPGMPKHGIAALADLPLTYDPRYRINLSILSPDTRG

Q9VWI5|DHX34?_Dm      ADFWKFVGKYE--AMMRSTGQPVLPPRLAEAELSSMQPYHRSKHLALRLDADELLQEAR-

Q9N437|smgl-2_Ce      -------------LGIMPTQLGHITPWLYRH-----------------------------

                                     : .:      *   .                             

 

Q14147|DHX34_Hs       SQGLGRHLPAERVAEFRRALLHYLDFGQKQAFGRLAKLQRERAALPIAQYGNRILQTLKE

Q9DBV3|DHX34_Mm.      RHGPGRGLPPERVSEFRRALLHYLDFQQKQAFGRLAKLQRERAALPIAQYGNRILQTLKE

Q9VWI5|DHX34?_Dm      ---------DQMQSQFRHILLVYLDFRQTEKFQRIRKLRQTQRNLPIARFRKDLREALDT

Q9N437|smgl-2_Ce      ---------------FEYAYHVALQFNQHQKFQKLQKLRKLQKELPIAERAGEIVELLKT

                                     *.      *:* * : * :: **:: :  ****.    : : *.

 

Q14147|DHX34_Hs       HQVVVVAGDTGCGKSTQVPQYLLAAGFSHVACTQPRRIACISLAKRVGFESLSQYGSQVG

Q9DBV3|DHX34_Mm.      HQVVVVAGDTGCGKSTQVPQYLLAAGFSHVACTQPRRIACISLAKRVGFESLSQYGSQVG

Q9VWI5|DHX34?_Dm      SRVVIVAGDTGCGKSTQVPQYLYDFGYRSIACTQPRRLACVSLCKRVAHELLDDYGSRVA

Q9N437|smgl-2_Ce      NQVLIVAGDTGCGKSTQVPQYLLKAGFTGVACTQPRRIACTALARRVAYETLNQYGSEVA

                       :*::*****************   *:  :*******:** :*.:**..* *.:***.*.

 

Q14147|DHX34_Hs       YQIRFESTRSAATKIVFLTVGLLLRQIQREPSLPQYEVLIVDEVHERHLHNDFLLGVLQR

Q9DBV3|DHX34_Mm.      YQIRFESTRSAATKIVFLTVGLLLRQIQREPSLPQYQVLIVDEVHERHLHNDFLLGVLQR

Q9VWI5|DHX34?_Dm      FQIRFERSRTKLTNILFITEGLLLRQLAVAANLDQYDALILDEIHERNLFGDFLLGVTKC

Q9N437|smgl-2_Ce      FQIRFETTKSQKTKLLFLTEGLLLRQMEKDSLLEKYNVIILDEVHERHLTSDLLIGLLRD

                      :***** :::  *:::*:* ******:   . * :*:.:*:**:***:* .*:*:*: :

 

Q14147|DHX34_Hs       LLPTRPDLKVILMSATINISLFSSYFSN--APVVQVPGRLFPIT----------------

Q9DBV3|DHX34_Mm.      LLPQRPDLKVILMSATINISLFSSYFSH--APVVQVPGRLFPITVVYQPQ--------EA

Q9VWI5|DHX34?_Dm      LLRARPQLKLILMSATINVELFHGYFGEEGARLVQVPGRLFPIKLRYLPPPALELKAGQA

Q9N437|smgl-2_Ce      LCTKRDDLKLILMSATINLDLFKGYFEG--APVVQVPGRLFPIDVRWHPIK------QFI

                      *   * :**:********:.** .**    * :**********                

 

Q14147|DHX34_Hs       ------------------------------------------------------------

Q9DBV3|DHX34_Mm.      DQTASKSEKLDPRPFLRVLEAIDNKYPPEERGDLLVFLSGMAEITTVLDAAQAYASLTQR

Q9VWI5|DHX34?_Dm      TSKRSQRNRIDPAPFVQVLSLIDQQYPTSERGDVLIFVSGVNEIESVVEAVHEYATEQTH

Q9N437|smgl-2_Ce      DQSDKKTHKIDPEPYLKILELIDKQFPSTQRGDALIFLNGVAEISMVAEHLKNYAELTNG

                                                                                 

 

Q14147|DHX34_Hs       -----------------VFDVAPPGVRKCILSTNIAETSVTIDGIRFVVDSGKVKEMSYD

Q9DBV3|DHX34_Mm.      WVVLPLHSALSVSDQDKVFDVAPAGVRKCILSTNIAETSVTIDGIRFVVDSGKVKEMSYD

Q9VWI5|DHX34?_Dm      WLVLPLHSGQAIADQSKVFDYAPEGMRKCIVSTNIAETSLTVDGVRFVVDSGKVKEMNFD

Q9N437|smgl-2_Ce      WIILMLHSTLSVEEQDKVFDQAPVGIRKCILSTNVAETSVTIDGIRFVIDSGKVNLIKHE

                                       *** ** *:****:***:****:*:**:***:*****: :..:

 

Q14147|DHX34_Hs       PQAKLQRLQEFWISQASAEQRKGRAGRTGPGVCFRLYAESDYDAFAPYPVPEIRRVALDS

Q9DBV3|DHX34_Mm.      PQAKLQRLQEFWISQASAEQRKGRAGRTGPGVCYRLYAESDYDAFAPYPVPEIRRVALDA

Q9VWI5|DHX34?_Dm      ATCKGQRLKEFWVSKSSADQRKGRAGRTGPGVCFRLYTAEQYNAFEAYPTPEIYRVPLDT

Q9N437|smgl-2_Ce      PGTGTQKLTEFWVSKASANQRKGRAGRTGPGICYRLYSQEQFEKMDDFTVSEINRVSLQE

                      .    *:* ***:*::**:************:*:***: .::: :  :...** **.*:

 

Q14147|DHX34_Hs       LVLQMKSMSVG-DPRTFPFIEPPPPASLETAILYLRDQGALDSSE----ALTPIGSLLAQ

Q9DBV3|DHX34_Mm.      LVLQMKSMSVG-DPRTFPFIEPPPPASVETAILYLQEQGALDSSE----ALTPIGSLLAQ

Q9VWI5|DHX34?_Dm      MLLQMVSMGLP-DVRAFPFIEAPETERIEQTILALKQHCALSVEE----KITPLGRSLAN

Q9N437|smgl-2_Ce      MALKMISLNLGLDPRTFPFIEKPSEDVLNEGLEVLKFQRVLRSDRGDILTLTALGNMVSK

                      : *:* *:.:  * *:***** *    ::  :  *: : .*  ..     :*.:*  :::

 

Q14147|DHX34_Hs       LPVDVVIGKMLILGSMFSLVEPVLTIAAALSVQSPFTRSAQSSPECCTP--PASS-----

Q9DBV3|DHX34_Mm.      LPVDVVIGKMLILGSMFSLAEPVLTIAAALSVQSPFTRSAQSNLDCATARRPLESDQGDP

Q9VWI5|DHX34?_Dm      LPVELSIGKMLLMGSVFPEVEQLLTLAAMLSVQNPLTNRAHTDQRCVRERESLESDHGDL

Q9N437|smgl-2_Ce      LPVEVPIAKMLVYGCVVDELEVMLTVAAGLSVQSPFTNRSYRELEIVERRASLTSPLGDP

                      ***:: *.***: *.:.   * :**:** ****.*:*. :  .        .  *    

 

Q14147|DHX34_Hs       ------------LAAPRCCTHRSWR-----------------------------------

Q9DBV3|DHX34_Mm.      FTLFNVFNAWVQVKSERSGNSRKWCRRRGVEEHRLYEMANLRRQFKELLEDHGLLSGAQV

Q9VWI5|DHX34?_Dm      FTLVRLYNVWVQLKMRRDG-TRQWCRRLGIEEQRFYEVTKLRQQFQRILESCGMVVASDS

Q9N437|smgl-2_Ce      FTLISIFREWV-LQKAFEGTARRWTMENGIDEHRLYEISKLRAQYRQILEDAGLVEKASA

                                  :        * *                                   

 

Q14147|DHX34_Hs       ------------------------------------------------------------

Q9DBV3|DHX34_Mm.      VAPG--DSYSRLQQRRERRALHQLKRQHEEGGGRRRKV-LRLQEDGCSSDEEDRKGSTSQ

Q9VWI5|DHX34?_Dm      DSQL--TSAERATRHGELRQLKAMKRRQRFEQPRQRKL-LKQSAGRVAEDEEEQ-----E

Q9N437|smgl-2_Ce      AETGEDDSRQRRIDQGEKRKLFDLKKSQRNNDRRQKVLNANKHFDKILEDKEEEDLEAEK

                                                                                  

 

Q14147|DHX34_Hs       ----------------------PATATEAETTRTR-------------------------

Q9DBV3|DHX34_Mm.      RADSVDIQDVKFKLRHNLEQLQAAASSAQDLTRDQLALLKLVLGRGLYPQLAVPDAFNSG

Q9VWI5|DHX34?_Dm      EAQGDDMRDVDFRLRFDPRQLALLERSSRLDRHSVVVLLKLLLGSGFYPQLAISDEFNYC

Q9N437|smgl-2_Ce      DPLKADVKTVEFLLSHKQRDVENIRKTHKISRKTAEVVR-VIIAAGLYPNFSILDPVNKY

                                                :     :                          

 

Q14147|DHX34_Hs       ------------------------------------------------------------

Q9DBV3|DHX34_Mm.      RKDSDQIFHTQAKQGTVLHPTCVFANSPEVLHTQGQEASGQEGSQDGRDQMSCKHQLLAF

Q9VWI5|DHX34?_Dm      KGGGQQFFHTRLKPFVLQHPNSQFAKHFELLKLTESDLLPKPDFYTPKLPLSKRHQLLCY

Q9N437|smgl-2_Ce      GYGQEMFTHTRLKPFTQIHPNSSIAQYHP----------ETIDPRQGSDGFSRLHQIPFY

                                                                                 

 

Q14147|DHX34_Hs       ------------------------------------------------------------

Q9DBV3|DHX34_Mm.      VSLLETNKPYLVNCVRIPALQSLLLFSRSIDTNGDCSRLVADGWLELQLADSESAVRLLA

Q9VWI5|DHX34?_Dm      QSLLETAKPYLINCIRLPAAQTLLLFSFAIDTNAGITQIACDGWLGLDLPMPGSGMELLR

Q9N437|smgl-2_Ce      GLLLETTKPYICNVMPVPAVYT-LLVAQKIVIEDDWSQLSIDDFLELRFRSSTDCRSVLL

                                                                                  

 

Q14147|DHX34_Hs       ------------------------------------------------------------

Q9DBV3|DHX34_Mm.      TSLRLRAHWESALDRQLARQAQRRKLEQEEDVGSPAVSPQEVAALSRELLQFMAAKVPYR

Q9VWI5|DHX34?_Dm      RAIELRRRWS----RLLYDKLDDLKSKQESPSHS---SDDRSSALWQDLVDYMALDVAYA

Q9N437|smgl-2_Ce      DAKEIR-----------YELTKGLAAKLVG---------EAGFSGRRRLAKYIDLLNQSI

                                                                                 

 

Q14147|DHX34_Hs       ------------------------------------------------------------

Q9DBV3|DHX34_Mm.      LRRLTGLEAQNLYVGPQTITTAPSLPG--LFGNSTLSPHPTKGGYAVSDYLTYNCLTS--

Q9VWI5|DHX34?_Dm      IRRLLPADIKRLYTHQAPSARLAELKENPFAVDFPMTPNEEKGGLNVSEHVVYSCLAEQQ

Q9N437|smgl-2_Ce      VEKGIEVAVRRN-VHPPKVLTGIGIHSPDGGIDKEEDVDDLVQRFERDQEPVHSAREEEL

                                                                                 

 

Q14147|DHX34_Hs       ------------------------------------------------------------

Q9DBV3|DHX34_Mm.      -DTDLYSDCLRSFWTCPHCGLHMP-FTPLERIAHENTCP------EAPGDDPGSEEAAPA

Q9VWI5|DHX34?_Dm      WTTAMDATLRAEPWQCTRCDFELEEFDVLEQLVHRSKCKRRKAQESRTAKTTSTESSTEV

Q9N437|smgl-2_Ce      EDQKVLDELRAD-VMCPPTRDMIEEAEKLKELKKK-----------EIPKESYYEKLLKR

                                                                                  

 

Q14147|DHX34_Hs       ---------------------------------------

Q9DBV3|DHX34_Mm.      PPQKTSALQRPYHCQVCGQDFLFTPTEVLRHRRQHV---

Q9VWI5|DHX34?_Dm      ASSSSSHSSGGYYCNSCKRELRLTTIDILRHKKQCRNNK

Q9N437|smgl-2_Ce      QKAKEDD-------EKTEKKPKLEPLDTMEE--------