S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein CG4901 DHX33
DHX33
Database Links
Cellular Function

Group Alignment

Q9H6R0|DHX33_HS      MPEEAGFPPAKRFRPGSGPPSRAGSFPPGRQVVMLLTAGSGGRGGGGGRRQQPPLAQPSA

Q80VY9|DHX33_Mm      MPEEASLPPAKRFRPGS--------CPPGRRVVMLLTAGGGG-GAGGGRRQTPPLAQPSA

Q9VL25|DHX33_Dm      -MDSKYFATSRNDAVGPSP----VKFSFKRKYDAMANSPILEKKPHVAQIKQT-IAPILL

                       :.  :..::.   *.         .  *:   : .:         .: : . :*   

 

Q9H6R0|DHX33_HS      SPYPEAVELQRRSLPILQARGQLLAQLRNLDNAVLIGETGSGKTTQIPQYLYEGGISRQG

Q80VY9|DHX33_Mm      SPYREALELQRRSLPIFRARGQLLAQLRNLDNAVLIGETGSGKTTQIPQYLYEGGISRQG

Q9VL25|DHX33_Dm      TSKRTSIEQQQKSLPVFNCRHRILKELEANDTVLIMSETGSGKTTQIPQFLLLAGYAKNG

                     :.   ::* *::***::..* ::* :*.  *..:::.************:*  .* :::*

 

Q9H6R0|DHX33_HS      IIAVTQPRRVAAISLATRVSDEKRTELGKLVGYTVRFDDVTSEDTGIKFLTDGMLLREAI

Q80VY9|DHX33_Mm      IIAVTQPRRVAAISLATRVSDEKRTELGKLVGYTVRFEDVTSEDTRIKFLTDGMLLREAI

Q9VL25|DHX33_Dm      MIGITQPRRVAAITVARRVAQELNGTIGDTVGYTVRFEDVTSRATKIRFLTDGVLLRESI

                     :*.:*********::* **::* .  :*. *******:****. * *:*****:****:*

 

Q9H6R0|DHX33_HS      SDSLLRKYSCVILDEAHERTIHTDVLFGVVKAAQKRRKELGKLPLKVIVMSATMDVDLFS

Q80VY9|DHX33_Mm      SDSLLRKYSCVILDEAHERTIHTDVLFGVVKTAQKRRKELGKLPLKVIVMSATMDVDLFS

Q9VL25|DHX33_Dm      KDRLLLKYSVIILDEAHERTVNADLLFGIVKDAQKERRKQKLANLKVVVTSATMDIDHFG

                     .* ** *** :*********:::*:***:** ***.*::     ***:* *****:* *.

 

Q9H6R0|DHX33_HS      QYFNGAPVLYLEGRQHPIQVFYTKQPQNDYLHAALVSVFQIHQEAPSSQDILVFLTGQEE

Q80VY9|DHX33_Mm      QYFNRAPVLYLEGRQHPIQIFYTKQPQQDYLHAALVSVFQIHQEAPASQDILVFLTGQEE

Q9VL25|DHX33_Dm      NYFN-CKGMYLEGRTYPVRVMHTKEEHEDYIHTVLVTLFHIHRTTPKNHDVLIFLTGQEE

                     :*** .  :***** :*:::::**: ::**:*:.**::*:**: :* .:*:*:*******

 

Q9H6R0|DHX33_HS      IEAMSKTCRDIAKHLPDGCPAMLVLPLYASLPYAQQLRVFQGAPKGYRKVIISTNIAETS

Q80VY9|DHX33_Mm      IEAMSKTCRDIARHLPDGCPSMLVLPLYASLPYSQQLRVFQGAPKGYRKVIISTNIAETS

Q9VL25|DHX33_Dm      IESLAQQIRQLAKIDTTGTTDLRVFTLYAQLSQGKQLECFVPTPANVRKVILATNIAETS

                     **::::  *::*:  . * . : *:.***.*. .:**. *  :* . ****::*******

 

Q9H6R0|DHX33_HS      ITITGIKYVVDTGMVKAKKYNPDSGLEVLAVQRVSKTQAWQRTGRAGREDSGICYRLYTE

Q80VY9|DHX33_Mm      ITITGIKYVVDTGMVKAKKYNPDSGLEVLAVQRVSKTQAWQRTGRAGREDSGICYRLYTE

Q9VL25|DHX33_Dm      ITIPGIRCVIDCGFVKEKSFNTVDGLDVLKSVRISKAQAWQRAGRAGRDADGTCYRAYTK

                     ***.**: *:* *:** *.:*. .**:**   *:**:*****:*****: .* *** **:

 

Q9H6R0|DHX33_HS      DEFEKFDKMTVPEIQRCNLASVMLQLLAMKVPNVLTFDFMSKPSPDHIQAAIAQLDLLGA

Q80VY9|DHX33_Mm      DEFEKFEKMTVPEIQRCNLASVILQLLAMKVPNVLTFDFMSKPSPDHIEAAIAQLDLLGA

Q9VL25|DHX33_Dm      AEMDSFADATQPEILRTNPTSMVLQLLALDID-CNNFDFLDPPLEDGLRSAYKSLDALGA

                      *::.* . * *** * * :*::*****:.:    .***:. *  * :.:*  .** ***

 

Q9H6R0|DHX33_HS      LEHKDDQLTLTPMGRKMAAFPLEPKFAKTILMSPKFHCTEEILTIVSLLSVDSVLHNPPS

Q80VY9|DHX33_Mm      LEHKDDQLTLTPIGRKMAAFPLEPRFAKTILLSSKFHCTEEILTIVSLLSVDSVLYNPPA

Q9VL25|DHX33_Dm      IKTGDD-SYITPLGRQMVQYPLDPKYSKLLLTASSFGCMEEILSLVSVLSSDHVFVSNSE

                     ::  **   :**:**:*. :**:*:::* :* :..* * ****::**:** * *: . .

 

Q9H6R0|DHX33_HS      RREEVQGVRKKFISSEGDHMTLLNIYRTFKNLGGNKDWCKENFVNSKNMTLVAEVRAQLR

Q80VY9|DHX33_Mm      RRDEVQSVRKKFISSEGDHITLLNIYRTFKNIGGNKDWCKENFVNSKNMLLVAEVRAQLR

Q9VL25|DHX33_Dm      KNEMAALAHAKFQSKHGDHLTLLNVFNGFLKSEKPKMWCHDNYLNLRSLTYARNVRRQLR

                     :.: .  .: ** *..***:****::. * :    * **::*::* :.:  . :** ***

 

Q9H6R0|DHX33_HS      DICLKMSMPIASSRGDVESVRRCLAHSLFMSTAELQPDGTYATTDTHQPVAIHPSSVLF-

Q80VY9|DHX33_Mm      EICLKMSMPIMSSRGDMESVRRCMAHSLFMNTAELQTDGTYATTDTHQPVAIHPSSVLF-

Q9VL25|DHX33_Dm      EISEHLHLALNSS-DDIEMLKKCILNGFFENIAVLQRDGFYITASGNIRSKIHPSSVLHG

                     :*. :: :.: ** .*:* :::*: :.:* . * ** ** * *:. :    *******.

 

Q9H6R0|DHX33_HS      HCKPACVVYTELLYTNKCYMRDLCVIDAQWLYEAAPEYFRRKLRTARN

Q80VY9|DHX33_Mm      HCKPACVVYTSLLYTNKCYMRDLCVVDAEWLYEAAPDYFRRKLRTARN

Q9VL25|DHX33_Dm      KYKPSYILFTEIVQTEQTFLRQVTEISIEWIKEVVP--FVKNIPTR--

                     : **: :::*.:: *:: ::*::  :. :*: *..*  * ::: *