S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Dhr2p
YKL078W
DHX32
DHX32
Database Links
Cellular Function Ribosome Biogenesis Mitochondrial RNA processing Mitochondrial RNA processing

Group Alignment

Q7L7V1|DHX32_Hs       ------------------------------------------------------------

Q8BZS9|DHX32_Mm       ------------------------------------------------------------

P36009|DHR2_Sc.       ------------------------------------------------------------

                                                                                 

 

Q7L7V1|DHX32_Hs       ------------------------------------------------------------

Q8BZS9|DHX32_Mm       ------------------------------------------------------------

P36009|DHR2_Sc.       ------------------------------------------------------------

                                                                                 

 

Q7L7V1|DHX32_Hs       ------------------------------------------------------------

Q8BZS9|DHX32_Mm       ------------------------------------------------------------

P36009|DHR2_Sc.       ------------------------------------------------------------

                                                                                  

 

Q7L7V1|DHX32_Hs       ------------------------------------------------------------

Q8BZS9|DHX32_Mm       ------------------------------------------------------------

P36009|DHR2_Sc.       ------------------------------------------------------------

                                                                                 

 

Q7L7V1|DHX32_Hs       ------------------------------------------------------------

Q8BZS9|DHX32_Mm       ------------------------------------------------------------

P36009|DHR2_Sc.       ------------------------------------------------------------

                                                                                  

 

Q7L7V1|DHX32_Hs       ------------------------------------------------------------

Q8BZS9|DHX32_Mm       ------------------------------------------------------------

P36009|DHR2_Sc.       ------------------------------------------------------------

                                                                                 

 

Q7L7V1|DHX32_Hs       ------------------------------------MEEEGLECPNSSSEKRYFPES---

Q8BZS9|DHX32_Mm       ------------------------------------MDEEELDHPNASPEKRYFPES---

P36009|DHR2_Sc.       ----------------------------------MAANSNSRVASNHTSKKQKVRRN---

                                                           : :     :  ..*:    .  

 

Q7L7V1|DHX32_Hs       ------------------------------------------------------------

Q8BZS9|DHX32_Mm       ------------------------------------------------------------

P36009|DHR2_Sc.       ---IHPFTNNTRIKRAS-------------------------------------------

                                                                                  

 

Q7L7V1|DHX32_Hs       ------------------LDSSDGDEEEVLACEDLELN-----------PFDGLPYSSR-

Q8BZS9|DHX32_Mm       ------------------LDSSDGDEEGVLACEDLELN-----------PFDGLPYSSR-

P36009|DHR2_Sc.       ---KIVKFND----------SGEGDHVSDQRSNKE----------------NVLTYKSLK

                                          *. ...       .                 : *. .. 

 

Q7L7V1|DHX32_Hs       -----------------------------------YYKLLKEREDLPIWKEKYSFMENLL

Q8BZS9|DHX32_Mm       -----------------------------------YYKLLKEREELPIWKEKYSFMESLL

P36009|DHR2_Sc.       SRAS---------------------------------DLLKMRETLPVYQHKREIMSYIE

                                                            *:: *: **::: : .::. :

 

Q7L7V1|DHX32_Hs       QNQIVIVSGDAKCGKSAQVPQWCAEYCLSIHYQHGGVICTQVHKQTVVQLALRVADEMDV

Q8BZS9|DHX32_Mm       QNQVVVVSGDSKCGKSSQVPQWCAEYCLSIHYQHGGVICTQAHKQTAVQLALRVADEMDV

P36009|DHR2_Sc.       SNPVTVLIGETGSGKSTQIPQFVLEKLYDTKK-HGSIAVTQPRRVAAINLATRVAQEHGC

                      .* : :: *:: .**::*:.*:  *     :   * :  ** :: :.:.:* ***:* .

 

Q7L7V1|DHX32_Hs       NIGHEVGYVIPFENCCTNETILRYCTDDMLQREMMSNPFLGSYGVIILDDIHERSIATDV

Q8BZS9|DHX32_Mm       NIGHEVGYVIPFENCCTTETILRYCTDDMLQREMMSNPFLGSYGVIILDDVHERSLATDV

P36009|DHR2_Sc.       KLGEQVGYSVRFDNTTTTRTRLKYLTDGMLLRELMMNSDLREYSVIVIDEAHERTVLTDL

                      .:*.:*** : *::  : .* ::* **.** ** : :. * .*.**::*: ***:: **:

 

Q7L7V1|DHX32_Hs       LLGLLKDVLL-ARPELKLIINSSPHLISKLNSYYGNVPVIEVKN-KHPVEVVYLSEAQKD

Q8BZS9|DHX32_Mm       LLGLLKDVLL-ARPELKLIVNCSPLLTSKLSSYYGDVPVIEVRN-KHPVEVVYLSGAQKD

P36009|DHR2_Sc.       ILGFLKSLIQGPRPDLRIIVMSATLQAEKFSEFFNNAPILFVEGRKFDVKQYYLKAPTDD

                      ::*:**  :   **:*::*: .:.    *:..:: ..*:: : . .. *:  * . .  *

 

Q7L7V1|DHX32_Hs       SFESILRLIFEIHHSGEKGDIVVFLACEQDIEKVCETVYQ-GSNLNPDLGELVVVPLYPK

Q8BZS9|DHX32_Mm       SFESVIRLIFEIHRSGEKGDVVVFLACEQDIEKTYELVCQEGSNLNPDVGDLVVIPLYPK

P36009|DHR2_Sc.       IVDAVIRCCIQINQGEELGDILCFLPGQEEIDKAVTIMEKIAKYVSDEAPVPLIVPYPLY

                       .:: :   ::*:     **:: **. :::*:..   : :  . :. :    :::*   

 

Q7L7V1|DHX32_Hs       EKCSLFKPLDETEKRCQVYQRRVVLTTSSGEFLIWSNSVRFVIDVGVERRKVYNPRIRAN

Q8BZS9|DHX32_Mm       EKCSLFRPVDETEKRCQVYQRRVVLTTSCGESLIWSHTVKFVIDVGLERRQVYNPRIRAN

P36009|DHR2_Sc.       AALPAVQQSLVFAP-IKGFKRKVVFSTNIAETSVTISGVKFVVDSGLRKVKVWRHQLGLA

                         .               .*:**::*. .*  :    : :*:* *. : :*:. :   

 

Q7L7V1|DHX32_Hs       SLVMQPISQSQAEIRKQILGSSSSGKFFCLYTEEFASKDMTPLKPAEMQEANLTSMVLFM

Q8BZS9|DHX32_Mm       SLVLQPISQSQAEIRKQLLGSSPSGKLFCLYTEEFASKDMRPLKPAEMQEANLTSMVLFM

P36009|DHR2_Sc.       TLLTVPISQASAMQRSGRAGRESEGKSFRLYCESDY-VKLPKQSEPEIARSDVTSPVLML

                      :*:  ****: *  *    *    ** : ** *     .:     .*: .::::: ** :

 

Q7L7V1|DHX32_Hs       KRIDIAGLGHCDFMNRPAPESLMQALEDLDYLAALDNDGNLSEFGIIMSEFPLDPQLSKS

Q8BZS9|DHX32_Mm       KRVDIAGLGRCDFMNRPAPESLMQALEDLDYLAALDNDGNLSEFGIIMSEFPLDPQLSKS

P36009|DHR2_Sc.       KRYGVDDLLNWTWFENPGKEAIVMGLQELYELGALDTRGKITKRGQQMALLPLQPHLSSV

                      *  .: .* .  ::: *  *::: .*::*  *.***  * ::. *  *: :**:*:**.

 

Q7L7V1|DHX32_Hs       ILASCEFDCVDEVLTIAAMVTAPNCFSHVPHGAEEAALTCWKTFLHPEG---DHFTLISI

Q8BZS9|DHX32_Mm       ILASCEFDCVDEMLTIAAMVTAPSCFLHVPHGAEEAAVTCWKTFLHPEG---DHFTLINV

P36009|DHR2_Sc.       LIKASEVGCLSQVIDIVSCLSVENLLLNPSPEERDEVNERRLSLCNAGKRYGDLIMLKEL

                      :: :  . * .::: *.: ::. . : .     .:       :  :      * : *  :

 

Q7L7V1|DHX32_Hs       YKAYQDTTLNSSSE-YCVEKWCRDYFLNCSALRMADVIRAELLEIIKRIELPYAEPAFGS

Q8BZS9|DHX32_Mm       YNAYQDTVLNSANE-HCVEMWCHDCFLSCSALRMADVIRAELLEIIKRIELPYAEPAFGS

P36009|DHR2_Sc.       FDIYFYELGKSQDASSERNDWCKGLCISIRGFKNVIRVRDQLRVYCKRLFSSISEEDEES

                      :.        * .     : **    :.   ::    :* :*    .*      .    *

 

Q7L7V1|DHX32_Hs       KENT------LNIKKALLSGYFMQIARDVDGSGNYLMLTHKQVAQLHPLSGYSITKKMPE

Q8BZS9|DHX32_Mm       KENG------LNIKKALLSGYFMQIARDVDGSGNYLMLTHKQVAQLHPLSSYSITKKMPE

P36009|DHR2_Sc.       KKIGEDGELISKILKCFLTGFIKNTAIGMPDRS-YRTVSTGEPISIHPSS-MLFMNKSCP

                                 .* *.: :*:: : *      . *  :   :   :** *   :  :  

 

Q7L7V1|DHX32_Hs       WVLFHKFSISENNYIRITSEISPELFMQLVPQYYFSNLPPSESKDILQQVVDHLSPVSTM

Q8BZS9|DHX32_Mm       WVLFHQFSISENNYIRVASAVSPELFMQLVPQYYFSNLPPSESKDILQQAAGHL-PTETV

P36009|DHR2_Sc.       GIMYTEYVFTTKGYARNVSRIELSWLQEVVT------NAAAVAKQKVSDSK---------

                       ::: :   : : * * .: :. . : :...       ..  :*   .:          

 

Q7L7V1|DHX32_Hs       NKEQQMCETCP-ETEQRCTLQ

Q8BZS9|DHX32_Mm       NKDQDVCDKCPDATEQRCTIQ

P36009|DHR2_Sc.       ---------------------