S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein DHX30
DHX30
Database Links
Cellular Function

Group Alignment

Q7L2E3|DHX30_Hs.         -----------------------MFSLDSFRKDRAQHRQRQCKLPPPRLPPMCVNPTPGG

Q99PU8|DHX30_Mm.         MVTPVCNSSTWQPKDSSFLSWPEMFSLDSFRKDRTQHRQRQCKLPPPRLPPMCVNPAPGG

                                                ***********:*********************:***

 

Q7L2E3|DHX30_Hs.         TISRASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLHIKWPKSV

Q99PU8|DHX30_Mm.         TITRASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLHIKWPKSV

                         **:*********************************************************

 

Q7L2E3|DHX30_Hs.         EVEGYGSKKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSPADSWWRPE

Q99PU8|DHX30_Mm.         EVEGYGSKKIDAERQAAAAACQLFKGWGLLGPRNELFDAAKYRVLADRFGSPADSWWRPE

                         ************************************************************

 

Q7L2E3|DHX30_Hs.         PTMPPTSWRQLNPESIRPGGPGGLSRSLGREEEEDEEEELEEGTIDVTDFLSMTQQDSHA

Q99PU8|DHX30_Mm.         PTMPPTSWRQLNPENIRPGGPAGLSRSLGREEEEDEEEELEEGTIDVTEFLSMTQQDSHN

                         **************.******.**************************:**********

 

Q7L2E3|DHX30_Hs.         PLRDSRGSSFEMTDDDSAIRALTQFPLPKNLLAKVIQIATSSSTAKNLMQFHTVGTKTKL

Q99PU8|DHX30_Mm.         PLRDSRGGSFEMTDDDSAIRALTQFPLPKNLLAKVIQIATSSSTAKNLMQFHTVGTKTKL

                         *******.****************************************************

 

Q7L2E3|DHX30_Hs.         STLTLLWPCPMTFVAKGRRKAEAENKAAALACKKLKSLGLVDRNNEPLTHAMYNLASLRE

Q99PU8|DHX30_Mm.         ATLTLLWPCPMTFVAKGRRKAEAENKAAALACKKLKSLGLVDRNNEPLTHAMYNLASLRE

                         :***********************************************************

 

Q7L2E3|DHX30_Hs.         LGETQRRPCTIQVPEPILRKIETFLNHYPVESSWIAPELRLQSDDILPLGKDSGPLSDPI

Q99PU8|DHX30_Mm.         LGETQRRPCTIQVPEPILRKIEAFLSHYPVDSSWISPELRLQSDDILPLGKDSGPLSDPI

                         **********************:**.****:****:************************

 

Q7L2E3|DHX30_Hs.         TGKPYVPLLEAEEVRLSQSLLELWRRRGPVWQEAPQLPVDPHRDTILNAIEQHPVVVISG

Q99PU8|DHX30_Mm.         TGKPYMPLSEAEEVRLSQSLLELWRRRGPIWQEAPQLPVDPHRDTILSAIEQHPVVVISG

                         *****:** ********************:*****************.************

 

Q7L2E3|DHX30_Hs.         DTGCGKTTRIPQLLLERYVTEGRGARCNVIITQPRRISAVSVAQRVSHELGPSLRRNVGF

Q99PU8|DHX30_Mm.         DTGCGKTTRIPQLLLERYVTEGRGARCNVIITQPRRISAVSVAQRVSHELGPSLRRNVGF

                         ************************************************************

 

Q7L2E3|DHX30_Hs.         QVRLESKPPSRGGALLFCTVGILLRKLQSNPSLEGVSHVIVDEVHERDVNTDFLLILLKG

Q99PU8|DHX30_Mm.         QVRLESKPPARGGALLFCTVGILLRKLQSNPSLEGVSHVIVDEVHERDVNTDFLLILLKG

                         *********:**************************************************

 

Q7L2E3|DHX30_Hs.         LQRLNPALRLVLMSATGDNERFSRYFGGCPVIKVPGFMYPVKEHYLEDILAKLGKHQYLH

Q99PU8|DHX30_Mm.         LQRLNPALRLVLMSATGDNERFSRYFGGCPVIKVPGFMYPVKEHYLEDILAKLGKHQYPH

                         ********************************************************** *

 

Q7L2E3|DHX30_Hs.         RHRHHESEDECALDLDLVTDLVLHIDARGEPGGILCFLPGWQEIKGVQQRLQEALGMHES

Q99PU8|DHX30_Mm.         RHRHHESEDECALDLDLVTDLVLHIDARGEPGGILCFLPGWQEIKGVQQRLQEALGMHES

                         ************************************************************

 

Q7L2E3|DHX30_Hs.         KYLILPVHSNIPMMDQKAIFQQPPVGVRKIVLATNIAETSITINDIVHVVDSGLHKEERY

Q99PU8|DHX30_Mm.         KYLILPVHSNIPMMDQKAIFQQPPLGVRKIVLATNIAETSITVNDIVHVVDSGLHKEERY

                         ************************:*****************:*****************

 

Q7L2E3|DHX30_Hs.         DLKTKVSCLETVWVSRANVIQRRGRAGRCQSGFAYHLFPRSRLEKMVPFQVPEILRTPLE

Q99PU8|DHX30_Mm.         DLKTKVSCLETVWVSRANVIQRRGRAGRCQSGFAYHLFPRSRLEKMVPFQVPEILRTPLE

                         ************************************************************

 

Q7L2E3|DHX30_Hs.         NLVLQAKIHMPEKTAVEFLSKAVDSPNIKAVDEAVILLQEIGVLDQREYLTTLGQRLAHI

Q99PU8|DHX30_Mm.         NLVLQAKIHMPEKTAVEFLSKAVDSPNIKAVDEAVILLQEIGVLDQREYLTTLGQRLAHI

                         ************************************************************

 

Q7L2E3|DHX30_Hs.         STDPRLAKAIVLAAIFRCLHPLLVVVSCLTRDPFSSSLQNRAEVDKVKALLSHDSGSDHL

Q99PU8|DHX30_Mm.         STDPRLAKAIVLAAIFRCLHPLLVVVSCLTRDPFSSSLQNRAEVDKVKALLSHDSGSDHL

                         ************************************************************

 

Q7L2E3|DHX30_Hs.         AFVRAVAGWEEVLRWQDRSSRENYLEENLLYAPSLRFIHGLIKQFSENIYEAFLVGKPSD

Q99PU8|DHX30_Mm.         AFVRAVAGWEEVLRWQDRTSRENYLEENLLYAPSLRFIHGLIKQFSENIYEAFLVGKPSD

                         ******************:*****************************************

 

Q7L2E3|DHX30_Hs.         CTLASAQCNEYSEEEELVKGVLMAGLYPNLIQVRQGKVTRQGKFKPNSVTYRTKSGNILL

Q99PU8|DHX30_Mm.         CTLPSAQCNEYSEEEELVKGVLMAGLYPNLIQVRQGKVTRQGKFKPNSVTYRTKSGNILL

                         ***.********************************************************

 

Q7L2E3|DHX30_Hs.         HKSTINREATRLRSRWLTYFMAVKSNGSVFVRDSSQVHPLAVLLLTDGDVHIRDDGRRAT

Q99PU8|DHX30_Mm.         HKSTINREATRLRSRWLTYFMAVKSNGSVFVRDSSQVHPLAVLLLTDGDVHIRDDGRRAT

                         ************************************************************

 

Q7L2E3|DHX30_Hs.         ISLSDSDLLRLEGDSRTVRLLKELRRALGRMVERSLRSELAALPPSVQEEHGQLLALLAE

Q99PU8|DHX30_Mm.         ISLSDSDLLRLEGDSRTVRLLREFRRALGRMVERSLRSELAALPLSVQQEHGQLLALLAE

                         *********************:*:******************** ***:***********

 

Q7L2E3|DHX30_Hs.         LLRGPCGSFDVRKTADD

Q99PU8|DHX30_Mm.         LLRGPCGSFDMRKTADD

                         **********:******