S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein YLR419W
CG9323 DHX29
DHX29
Database Links
Cellular Function

Group Alignment

Q7Z478|DHX29_Hs.         MGGKNKKHKAPAAAVVRAAVSASRAKSAEAGIAGEAQSKKPVSRPATAAAAAAGSREPRV

Q6PGC1|DHX29_Mm.         MGGKNKKHKAPGAAAMRAAVSASRARSAEAGAVGEAQSKKPVARP--APAVPTGAREPRV

Q8SWT2|GH12763p_Dm.      ------------------------------------------------------------

Q06698|YLR419w_Sc.       --MAKKTKNNSKSSTPVNDVPTTAGKKKAKGKKGQEPEPEDDKRAKQQSNRAKVTSTASW

                                                                                    

 

Q7Z478|DHX29_Hs.         KQGPKIYSFNSTNDSSGPANLDKSILKVVINNKLEQRIIGVINEHKKQNNDKGMISGRLT

Q6PGC1|DHX29_Mm.         KQGPKIYSFNSANDSGGSANLDKSILKVVINNKLEQRIIGVINEHKKQNSDRGAISGRLS

Q8SWT2|GH12763p_Dm.      ------------------------------------------------------------

Q06698|YLR419w_Sc.       TGKLPHTILHETCQKRKWNKVEYDMKKIGDKGFIAIAVLSFTDPKTKETLTARMNDPTYD

                                                                                    

 

Q7Z478|DHX29_Hs.         AKKLQDLYMALQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFE

Q6PGC1|DHX29_Mm.         AKKLQDLYMALQAFSFKTKDIEDAMTNTLLHGGDLHSALDWLCLNLSDDALPEGFSQEFE

Q8SWT2|GH12763p_Dm.      ------------------------------------------------------------

Q06698|YLR419w_Sc.       KASGKGLVIPQETPIEARHMASTIALYRIAYNTNLHMMLPPNHR--KTWYALDDFRKDNL

                                                                                     

 

Q7Z478|DHX29_Hs.         EQQPKSRPKFQSPQIQATISPPLQPKTKTYEEDPKSKPKKEEKNMEVNMKEWILRYAEQQ

Q6PGC1|DHX29_Mm.         EQQPKSRPKFQSVQIQATLSPPQQTKTKRQEEDPKIKPKKEETTVEVNMKEWILRYAEQQ

Q8SWT2|GH12763p_Dm.      ------------------------------------------------------------

Q06698|YLR419w_Sc.       KTDEKRINKLFDLDPFKTMVEDRKLKAQREKEQVAQNNQAQKEQVARTILSSHGGISSSG

                                                                                    

 

Q7Z478|DHX29_Hs.         NEEEKNENSKSLEEEEKFDPNERYLHLAAKLLDAKEQAATFKLEKNKQGQKEAQEKIRKF

Q6PGC1|DHX29_Mm.         DEEEKGEGSKGLEEEEKFDPNQRYLNLAARLLDAKEQAAAFKLEKNKQGQKEAQEKIRKF

Q8SWT2|GH12763p_Dm.      -----------------------------------------------------------M

Q06698|YLR419w_Sc.       KDRQERKVASHKNSHNPSLVRFPKKVWENSIFVDLDESSRQLIETSLKEKIDWQAKKISH

                                                                                    

 

Q7Z478|DHX29_Hs.         QREMETLEDHPVFNPAMKISHQQNERKKPPVATEGESALNFNLFEK-------SAAATEE

Q6PGC1|DHX29_Mm.         QREMETLEDHPIFNPAIKISHQQNEKKKPAPATEAESALNLNLFEK-------SAAATEE

Q8SWT2|GH12763p_Dm.      QRDRDSSGSN------------ARKGNRPPGLRGKDIGLYYRNLAR-------QQKKDRG

Q06698|YLR419w_Sc.       KNETIAENREDLKAKLLTLQFRPKHVEEAMLYKDPLSFLLFNLPEDDLPPFFHKKKGDTK

                         :.:  :   .             .. :..         *  .           .     

 

Q7Z478|DHX29_Hs.         EKDKKKEPHDVRNFDYTARSWTGKSPKQFLIDWVRKNLPKSPNPSFEKVPVGRYWKCRVR

Q6PGC1|DHX29_Mm.         EKGKKKEPHDVRNFDYTARSWTGKSPKQFLIDWVRKNLPKSPNPSFEKVAVGRYWKCRVR

Q8SWT2|GH12763p_Dm.      ENAESKEPQIRLGCNVSAPSGVLERVKELMEDYSRAPSRQNVDDKNVDAKFQQQFRHLLS

Q06698|YLR419w_Sc.       NKVEITNLPLSTRMIVERLTEIGVSSDEALLALQQNDMNENEAAGFLTREILPTLNSNTN

                         :: : .:            :      .: :    :    :.         .    .   

 

Q7Z478|DHX29_Hs.         VIKSEDDVLVVCPTILTEDGMQAQHLGATLALYRLVKGQSVHQLLPPTYRDVWLEWSDAE

Q6PGC1|DHX29_Mm.         VVRSEDDVLVVCPTILTEDGMQAQHLGATLALYRLVKGQSVHQLLPPTYRDVWLEWSDEE

Q8SWT2|GH12763p_Dm.      VN--------------------------------------------------FEEFVAET

Q06698|YLR419w_Sc.       EPVSETESIECWNQELESLESIYEGCVMDAKEDSHYTLNLIEKLKIKLKVYRTKNYPASL

                                                                               ::   

 

Q7Z478|DHX29_Hs.         KKREELNKMETNKPRDLFIAKLLNKLKQQQQQ----------------------------

Q6PGC1|DHX29_Mm.         KKREELNKMETNKPRDLFIAKLLNKLKQQQQQ----------------------------

Q8SWT2|GH12763p_Dm.      KER--------NADLDWVNPKLDERLQLELGQ----------------------------

Q06698|YLR419w_Sc.       PGIVVSTFDKNYKLPDYIKKQILTRLLHYLQEGNLIGDMLVYHIYEWLKENISKIIDNPG

                                        * .  ::  :*     :                           

 

Q7Z478|DHX29_Hs.         QQQHS-ENKRENSEDPEESWENLVSDEDFSALSLESANVEDLEPVRNLFRKLQSTPKYQK

Q6PGC1|DHX29_Mm.         QQQQRPESEKGGSEDPEESWENLVSDEDLAALSLEPTSAEDLAPVRSLFRRLQSTPKYQR

Q8SWT2|GH12763p_Dm.      RQLEENAKKR--------------------------------------------------

Q06698|YLR419w_Sc.       PLIPDSDSKGAINKRNISNGKRSINNSSSRKFTKTTISEDTLSVLREEYTKRIKSSEYKS

                                .:                                                   

 

Q7Z478|DHX29_Hs.         LLKERQQLPVFKHRDSIVETLKRHRVVVVAGETGSGKSTQVPHFLLEDLLLNEWEASKCN

Q6PGC1|DHX29_Mm.         LLKERQQLPVFKHRDSIVETLKRHRVVVVAGETGSGKSTQVPHFLLEDLLLDECGARKCN

Q8SWT2|GH12763p_Dm.      -LEARKKLPTMKYADDIIQAVRENQVILIVGSTGCGKTTQVPQILLDDAISRGCAS-SCR

Q06698|YLR419w_Sc.       MQLVREQLPAWKKQKVIIDIINKNEVVLITGETGSGKSTQVVQFILDFLQKEKGDFGKTK

                             *::**. *  . *:: :..:.*:::.*.**.**:*** :::*:          . .

 

Q7Z478|DHX29_Hs.         IVCTQPRRISAVSLANRVCDELGCENGPGGRNSLCGYQIRMESR-ACESTRLLYCTTGVL

Q6PGC1|DHX29_Mm.         IVCTQPRRISAVSLATRVCEELGCESGPGGRNSLCGYQIRMESR-ASESTRLLYCTTGVL

Q8SWT2|GH12763p_Dm.      IICTQPRRISAIAIAEWVSYERCESLG-----NSVGYQIRLESRKARERASITYCTTGVL

Q06698|YLR419w_Sc.       IVCTQPRRISAIGLAERVSDERCVTCG-----EEVGYVIRGVNK-TKASTRIKFMTTGVL

                         *:*********:.:*  *. *     *     .  ** **  .: :   : : : *****

 

Q7Z478|DHX29_Hs.         LRKLQEDGLLSNVSHVIVDEVHERSVQSDFLLIILKEILQKRSDLHLILMSATVDSEKFS

Q6PGC1|DHX29_Mm.         LRKLQEDGLLADVSHVIVDEVHERSVQSDFLLVILKEILQKRSDLHLILMSATVDSDKFS

Q8SWT2|GH12763p_Dm.      LQQLQSDPLMHNLSVLILDEIHERSVETDLLMGLLKVILPHRPDLKVILMSATVREQDFC

Q06698|YLR419w_Sc.       VRLLQNARTMLENTIVVIDEVHERSIDTDLIVTLMKNLLHRVRGMKIVLMSATVNVDLFK

                         :: **.   : : : :::**:****:::*::: ::* :* :  .::::******  : *

 

Q7Z478|DHX29_Hs.         TYFTHCPILRISGRSYPVEVFHLEDIIEETGFVLEKDSEYCQKFLEEEEEVTINVTSKAG

Q6PGC1|DHX29_Mm.         TYFTHCPILRISGRSYPVEVFHLEDIVEETGFVLEKDSEYCQKFLEEEEEITINVTSKAG

Q8SWT2|GH12763p_Dm.      DYFNNCPMFRIEGVMFPVKMLYLEDVLSKTNYEFQKFRDRRPKRDPPERRMKHEAMIEP-

Q06698|YLR419w_Sc.       KFFPGLATCHIEGRTFPITDYFLEDILSDLDFKIKREKALSYDDDSVDERNNDDQYLKP-

                          :*   .  :*.*  :*:   .***::.. .: :::      .    :.. . :   :.

 

Q7Z478|DHX29_Hs.         GIKKYQEYIPVQTGAHADLNPFYQKYSSRTQHAILYMN-PHKINLDLILELLAYLDKSPQ

Q6PGC1|DHX29_Mm.         GVKKYQEYIPVQSGASPELNPFYQKYSSRTQHAILYMN-PHKINLDLILELLVYLDKSPQ

Q8SWT2|GH12763p_Dm.      -----------------YLRRIRNSYDSRVLDKLRLPESEGCEDIDFIADLVYYICEN--

Q06698|YLR419w_Sc.       ----------------------------RADSKFFTSG---QINYDLLCQVVEYVHKRLK

                                                     *.   :         : *:: ::: *: :  

 

Q7Z478|DHX29_Hs.         FRNIEGAVLIFLPGLAHIQQLYDLLS----NDRRFYSERYKVIALHSILSTQDQAAAFTL

Q6PGC1|DHX29_Mm.         FRNIEGAVLIFLPGLAHIQQLYDLLS----SDRRFYSERYQVIALHSVLSTQDQAAAFMF

Q8SWT2|GH12763p_Dm.      --EPEGAILVFLPGYDKISQLYNILDKPKTSKGQRWRDHMAVFPLHSLMQSGEQQAVFRR

Q06698|YLR419w_Sc.       AANDNGSIIVFLPGVGEINKCCNLLAN------KSNEADFMVLPLHSALTPEDQKRVFKK

                           : :*::::****  .*.:  ::*        :       *:.*** : . :*  .* 

 

Q7Z478|DHX29_Hs.         PPPGVRKIVLATNIAETGITIPDVVFVIDTGRTKENKYHESSQMSSLVETFVSKASALQR

Q6PGC1|DHX29_Mm.         PPPGVRKIVLATNIAETGITIPDVVFVIDTGRTKENKYHESSQMSSLVETFVSKASALQR

Q8SWT2|GH12763p_Dm.      PPAGQRKVIISTIIAETSVTIDDVVYVINSGRTKATNYDIETNIQSLDEVWVTKANTQQR

Q06698|YLR419w_Sc.       -YHGKRKVVVSTNIAETSITIDDCVATIDTGRAKSMFYNPKDNTTKLIESFISKAEVKQR

                            * **::::* ****.:** * * .*::**:*   *. . :  .* * :::**.. **

 

Q7Z478|DHX29_Hs.         QGRAGRVRDGFCFRMYTRERFE-GFMDYSVPEILRVPLEELCLHIMKCNLGSPEDFLSKA

Q6PGC1|DHX29_Mm.         QGRAGRVRDGFCFRLYTRERFE-GFLDYSVPEILRVPLEELCLHIMKCDLGSPEDFLSKA

Q8SWT2|GH12763p_Dm.      RGRAGRVRPGICYNLFSRARED-RMDDIPTPEILRSKLESIILSLKLLHIDDPYRFLQTL

Q06698|YLR419w_Sc.       RGRAGRVREGLSYKLFSKNLYENDMISMPIPEIKRIPLESLYLSVKAMGIKDVKAFLSTA

                         :******* *:.:.::::   :  : . . *** *  **.: * :    : .   **..

 

Q7Z478|DHX29_Hs.         LDPPQLQVISNAMNLLRKIGACELNEPKLTPLGQHLAALP-VNVKIGKMLIFGAIFGCLD

Q6PGC1|DHX29_Mm.         LDPPQLQVISNAMNLLRKIGACEPNEPKLTPLGQHLAALP-VNVKIGKMLIFGAIFGCLE

Q8SWT2|GH12763p_Dm.      INAPNPEAIKMGVELLKRIEALDQTG-TLTPLGMHLAKLP-IDPQMGKMILMSALFCCLD

Q06698|YLR419w_Sc.       LDAPPLPALQKAERILTTIGLVDESDKSLTQLGQFISLMPVMDSKHGKLLIYGILFGCTD

                         ::.*   .:. . .:*  *   : .  .** ** .:: :* :: : **::: . :* * :

 

Q7Z478|DHX29_Hs.         PVATLAAVMTE-KSPFTTPIGRKDEADLAKSALAMAD-SDHLTIYNAYLGWKKARQEGGY

Q6PGC1|DHX29_Mm.         PVATLAAVMTE-KSPFITPIGRKDEADLAKSSLAVAD-SDHLTIYNAYLGWKKAQQEGGF

Q8SWT2|GH12763p_Dm.      PITSAAAALSF-KSPFYSPLGKESRVDEIKRRMARNMRSDHLMVHNTIIAYRDSRYS---

Q06698|YLR419w_Sc.       ISVLLVSILGIGVLPFIGGFENREKIKKLLCKYESRG--DLFAVLEIVRDYFKIKDS---

                           .  .: :     **   : .... .            * : : :    : . : .  

 

Q7Z478|DHX29_Hs.         RSEITYCRRNFLNRTSLLTLEDVKQELIKLVKAAGFSSSTTSTSWEGNRASQTLSFQEIA

Q6PGC1|DHX29_Mm.         RSEISYCQRNFLNRTSLLTLEDVKQELMKLVKAAGFSS---SPSWEGRKGPQTLSFQDIA

Q8SWT2|GH12763p_Dm.      HAERDFCYKNFLSSMTLQQLERMKNQFSELLYNYKFLASSNCKDAASNKNS-----EKIP

Q06698|YLR419w_Sc.       SIKRKYLRDNLLSYNKINEIKSSTAQYYSILKDVGFLPMDYKVGSISDLNRNE---RNFD

                           :  :   *:*.  .:  ::  . :  .::    * .     .  .         ..:

 

Q7Z478|DHX29_Hs.         LLKAVLVAGLYDNVGKIIY---------------------------------------TK

Q6PGC1|DHX29_Mm.         LLKAVLAAGLYDSVGKIMC---------------------------------------TK

Q8SWT2|GH12763p_Dm.      LLRAIIGAGLYPNMAHLRK---------------------------------------SR

Q06698|YLR419w_Sc.       ILRAILTGAFYPHIARVQLPDVKYLSTSSGAVEKDPEAKMIKYWIRSEEYQDKLEEYKTK

                         :*:*:: ..:*  :.::                                         ::

 

Q7Z478|DHX29_Hs.         SVDVTEKLACIVETAQG-KAQVHPSSVNRDLQTHG-------------------------

Q6PGC1|DHX29_Mm.         SVDVTEKLACMVETAQG-KAQVHPSSVNRDLQTYG-------------------------

Q8SWT2|GH12763p_Dm.      QIKNRVRAIHTMATDDGRRVNFHPSSVNSGESGFDSA-----------------------

Q06698|YLR419w_Sc.       ISQETQKVDLEDLPLPATRAFIHPSSVLFSTNSVNLEDAKLLSEVDGPISRQSKIPTVVK

                           .   :      .  . :. .*****  . .  .                        

 

Q7Z478|DHX29_Hs.         --WLLYQEKIRYARVYLRETTLITPFPVLLFGG----DIEVQHRERLLSIDGWIYFQAPV

Q6PGC1|DHX29_Mm.         --WLLYQEKVRYTRVYLRETTLITPFPVLLFGG----DIEVQHRERLLSVDGWIYFQAPV

Q8SWT2|GH12763p_Dm.      --YFVYFQRQKSTDLFLLDSTMVFPMALIIFGDGV--EAGVTQNTPYLCVAKTYYFKCNR

Q06698|YLR419w_Sc.       YPFVLFTTSQVTNKLYLRDLTPTTTLSLLLFGGAISYDIGGTIHSPGIVVDNWLPIRTWC

                           :.::        ::* : *   .:.:::**.    :     .   : :     ::  

 

Q7Z478|DHX29_Hs.         KIAVIFKQLRVLIDSVLRKKLENP----KMSLEN---DKILQIITELIKTENN-------

Q6PGC1|DHX29_Mm.         KIAVIFKQLRVLIDSVLRKKLENP----KMSLEN---DKILQIITELIKTENN-------

Q8SWT2|GH12763p_Dm.      ETADVVIQLRSNLEKLLLKKALYP----APIEENGYEKQLIKAIELLLSLDERLGEDYIS

Q06698|YLR419w_Sc.       KNGVLIKELRTQLDEAIRKKLESPDYAKKSQIDNSGADKTLKIVEKIIASEQ--------

                         : . :. :**  ::. : **   *        :*   .: :: :  ::  ::       

 

Q7Z478|DHX29_Hs.         -------

Q6PGC1|DHX29_Mm.         -------

Q8SWT2|GH12763p_Dm.      SDEIDDI

Q06698|YLR419w_Sc.       -------