S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Prp43p
YGL120C
DHX15 CG11107 DHX15
DHX15
Database Links
Cellular Function pre-mRNA splicing Ribosome biogenesis

Prp43 / DHX15 Group Alignment

O43143|DHX15_HUMAN       MSKRHRLDLGEDYPSGKKRAGTDGKDRDRDRDREDRSKDRDRERDRGDREREREKEKEKE

O35286|DHX15_MOUSE.      MSKRHRLDLGEDYPSGKKRAGTDGKDRERDRDREDRSKDRDRERDRGDREREREKEKEKE

Q7K3M5|Prp43_DROME       MSKR-RIEVGETYGSKAK--------------------------------KDPEASSSSA

Q20875|DHX15_CAEEL       MSSRHRLDLDGSGRGDRRRS---------------------------PNRRSRSRSRSPH

P53131|PRP43_SC.         MGSKRRFSSEHPDPVETSIP---------------------------EQAAEIAEELSKQ

                         *..: *:.                                           .   . . 

 

O43143|DHX15_HUMAN       LRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTN

O35286|DHX15_MOUSE.      LRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHTGHTGHTSLPQCINPFTN

Q7K3M5|Prp43_DROME       AAAAGTVAQILGGFVPNKQ--------------------------------PPTMNPLTN

Q20875|DHX15_CAEEL       RRSSPDRKRQIGAVGNMKIQ----------------------------------INPYNN

P53131|PRP43_SC.         HPLPSEEPLVHHDAGEFKGLQRHHTSAEEAQKLE-----------------DGKINPFTG

                            .             *                                    :** ..

 

O43143|DHX15_HUMAN       LPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMR-

O35286|DHX15_MOUSE.      LPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMR-

Q7K3M5|Prp43_DROME       TPYSQRYQNLYKKRIALPVFEYQADFMRLLSLHQCIVLVGETGSGKTTQIPQWCVDFAV-

Q20875|DHX15_CAEEL       QPFSNRYWAIWEKRSQLPVWEYKEKFMELLRNNQCITLVGETGSGKTTQIPQWAVEFMKQ

P53131|PRP43_SC.         REFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEM-

                           .: :*  : : *  ***   :  *  :   :* :.:**************: :    

 

O43143|DHX15_HUMAN       ----SLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKY

O35286|DHX15_MOUSE.      ----SLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKY

Q7K3M5|Prp43_DROME       ----SKG--RKGVSCTQPRRVAAMSVAQRVSEEMDVKLGEEVGYSIRFEDCSTAKTLLKY

Q20875|DHX15_CAEEL       QQQGQPPGQARLVACTQPRRVAAMSVATRVAEEMDVVLGQEVGYSIRFEDCISERTVLKY

P53131|PRP43_SC.         -----PHLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKY

                                     *:************* **::**** **:*********:  : :*:***

 

O43143|DHX15_HUMAN       MTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATL

O35286|DHX15_MOUSE.      MTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATL

Q7K3M5|Prp43_DROME       MTDGMLLREAMSDPMLDQYQVILLDEAHERTLATDILMGVLKEVIRQRSDLKLVVMSATL

Q20875|DHX15_CAEEL       CTDGMLLREAMNSPLLDKYKVLILDEAHERTLATDILMGLIKEIVRNRADIKVVIMSATL

P53131|PRP43_SC.         MTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRPDLKIIIMSATL

                          **********..  *.:*  ::****************::*::::.*.*:*:::*****

 

O43143|DHX15_HUMAN       DAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLF

O35286|DHX15_MOUSE.      DAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLF

Q7K3M5|Prp43_DROME       DAGKFQQYFDNAPLMKVPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEIEGDILMF

Q20875|DHX15_CAEEL       DAGKFQRYFEDCPLLSVPGRTFPVEIFFTPNAEKDYLEAAIRTVIQIHMVEEVEGDILLF

P53131|PRP43_SC.         DAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQRDYLDSAIRTVLQIHATEEA-GDILLF

                         ** *** **::.**: :****.***:::**: ::***::*****:***  **  **:*:*

 

O43143|DHX15_HUMAN       LTGQEEIDEACKRIKREVDDLG--PEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAI

O35286|DHX15_MOUSE.      LTGQEEIDEACKRIKREVDDLG--PEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAI

Q7K3M5|Prp43_DROME       LTGQEEIEEACKRIKREIDNLG--SEIGELKCIPLYSTLPPNLQQRIFEPAPPPNANGAI

Q20875|DHX15_CAEEL       LTGQEEIEEACKRIDREIQALG--ADAGALSCIPLYSTLPPAAQQRIFEPAPPNRPNGAI

P53131|PRP43_SC.         LTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPPHQQQRIFEPAP-ESHNGRP

                         ***::**::* ::*. * : *      * :.  ***.:***  *******.*    ** 

 

O43143|DHX15_HUMAN       GRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRA

O35286|DHX15_MOUSE.      GRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRA

Q7K3M5|Prp43_DROME       GRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVSPISKASAQQRSGRA

Q20875|DHX15_CAEEL       SRKCVISTNIAETSLTIDGVVFVIDPGFSKQKVYNPRIRVESLLVCPISKASAMQRAGRA

P53131|PRP43_SC.         GRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRA

                         .** *:*************:*:*:****:**************** .****** **:***

 

O43143|DHX15_HUMAN       GRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAP

O35286|DHX15_MOUSE.      GRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAP

Q7K3M5|Prp43_DROME       GRTRPGKCFRLYTEKAFKNEMQDNTYPEILRSNLGTVVLQLKKLGIDDLVHFDFMDPPAP

Q20875|DHX15_CAEEL       GRTKPGKCFRLYTETAYGSEMQDQTYPEILRSNLGSVVLQLKKLGTEDLVHFDFMDPPAP

P53131|PRP43_SC.         GRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAP

                         ***:********** *: .*: :::*********.:.**:***** :*************

 

O43143|DHX15_HUMAN       ETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAM

O35286|DHX15_MOUSE.      ETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAM

Q7K3M5|Prp43_DROME       ETLMRALELLNYLAALDDDGNLTDLGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAM

Q20875|DHX15_CAEEL       ETLMRALELLNYLQAINDDGELTELGSLMAEFPLDPQLAKMLITSTELNCSNEILSITAM

P53131|PRP43_SC.         ETMMRALEELNYLACLDDEGNLTPLGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAM

                         **:***** **** .::*:*:** ** : ::***** ** *:* * : :**:*:*:*.**

 

O43143|DHX15_HUMAN       LSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQ----WCYDNFI

O35286|DHX15_MOUSE.      LSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQ----WCYDNFI

Q7K3M5|Prp43_DROME       LSVPQCFVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPN----WCYENFI

Q20875|DHX15_CAEEL       LSVPQCWVRPNEMRTEADEAKARFAHIDGDHLTLLNVYHSFKQNQEDPQ----WCYDNFI

P53131|PRP43_SC.         LSVPNVFIRPTKDKKRADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGIHKWCRDHYL

                         ****: ::**.: :. **:**  *** ****:*******:**..         ** ::::

 

O43143|DHX15_HUMAN       NYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLER-TG

O35286|DHX15_MOUSE.      NYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLER-TG

Q7K3M5|Prp43_DROME       NFRSLKSADNVRQQLARIMDRFNLRRTSTEFTSKDYYVNIRKALVQGFFMQVAHLER-TG

Q20875|DHX15_CAEEL       NYRTMKTADTVRTQLSRVMDKYNLRRVSTDFKSRDYYLNIRKALVAGFFMQVAHLER-SG

P53131|PRP43_SC.         NYRSLSAADNIRSQLERLMNRYNLELNTTDYESPKYFDNIRKALASGFFMQVAKKRSGAK

                         *:*:: :**.:* ** *:*:::**   :*:: * .*: ******. *:*****: .  :

 

O43143|DHX15_HUMAN       HYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDM

O35286|DHX15_MOUSE.      HYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDM

Q7K3M5|Prp43_DROME       YYLTIKDNQNVQLHPSTCLDHKPDWVIYNEFVLTTKNYIRTVTDVKPEWLCCLAPQYYDL

Q20875|DHX15_CAEEL       HYVTVKDNQLVNLHPSTVLDHKPEWALYNEFVLTTKNFIRTVTDVRPEWLLQIAPQYYDL

P53131|PRP43_SC.         GYITVKDNQDVLIHPSTVLGHDAEWVIYNEFVLTSKNYIRTVTSVRPEWLIEIAPAYYDL

                          *:*:**** * :**** *.*..:*.:*******:**:*** *.::****  :** ***:

 

O43143|DHX15_HUMAN       SNFPQCEAKRQLDRIIAKLQ---------SKEYSQY---

O35286|DHX15_MOUSE.      SNFPQCEAKRQLDRIIAKLQ---------SKEYSQY---

Q7K3M5|Prp43_DROME       NNFPQCEAKRQLELLQQRLE---------TKQYQKGF--

Q20875|DHX15_CAEEL       DNFPDGDTKRKLTTVMQTLQ---------RNAGRGY---

P53131|PRP43_SC.         SNFQKGDVKLSLERIKEKVDRLNELKQGKNKKKSKHSKK

                         .** . :.* .*  :   ::          :