S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Vasa
vbh-1
Y54E10A.9
Vasa
CG3506
DDX4 DDX4
Database Links
Cellular Function Translation

Group Alignment

Q9NQI0|DDX4_HUMAN         ---------------------------------------------------------MGD
sp|Q61496|DDX4_MOUSE      ---------------------------------------------------------MGD
sp|P34689|GLH1_CAEEL      ------------------------------------------------------MSDGWS
sp|Q966L9|GLH2_CAEEL      MSDDWDNNTAAAKTISFGSNPSGFGGGSGFGSGNTGGFGSGNAGGTGFGSSNNGGSGFGG
sp|O01836|GLH3_CAEEL      ------------------------------------------------------------
P09052|VASA_DROME         ----------------------------------------------------------MS
                                                                                      
 
Q9NQI0|DDX4_HUMAN         EDWEAEIN-PHMSSYVPIFEKDRYS-GENGDNFNRTPASSSEMDDGPSRRDHFMKSGFAS
sp|Q61496|DDX4_MOUSE      EDWEAEILKPHVSSYVPVFEKDKYSSGANGDTFNRTSASS--------------------
sp|P34689|GLH1_CAEEL      DSESAAKAKTGFGSGGGFGGGNNGGSGFGGGKNGGTGFGGGNTGGSGFGGGNTGGSGFGG
sp|Q966L9|GLH2_CAEEL      NNNVGPRFGNGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGG
sp|O01836|GLH3_CAEEL      -----MDKSPTKTSIRTKFARHQPISDVDTTEQSSSCIKKDDRGLSSFGVQSSVFSRRSC
P09052|VASA_DROME         DDWDDEPIVDTRGARGGDWSDDEDTAKSFSGEAEGDGVGGSG------------------
                                       .       .                                      
 
Q9NQI0|DDX4_HUMAN         GRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNP
sp|Q61496|DDX4_MOUSE      -------DIGESSKKENTSTTGGFGRGKGFGNRGFLNNKFEEGDSSGFWKESNNDCEDNQ
sp|P34689|GLH1_CAEEL      GKTGGSGFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFG
sp|Q966L9|GLH2_CAEEL      GNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGS
sp|O01836|GLH3_CAEEL      RMSELEAKPTIISEDQRIAVRSEIGGSFSGFDDKVDNVFHSNNNLHGSPSTTELECPGIM
P09052|VASA_DROME         -------GEGGGYQGGNRDVFGRIGGGRGGGAGGYRGGNRDGGGFHGGRREGERDFRGGE
                                               .  *   .       .         *             
 
Q9NQI0|DDX4_HUMAN         TRNRGFSKRG--------------------------------------------------
sp|Q61496|DDX4_MOUSE      TRSRGFSKRG--------------------------------------------------
sp|P34689|GLH1_CAEEL      GSATGFGSGGGSFGGGNS------------------------------------------
sp|Q966L9|GLH2_CAEEL      GKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSGFGSGGNS
sp|O01836|GLH3_CAEEL      NPRFLVGRSLNSRS----------------------------------------------
P09052|VASA_DROME         GGFRGGQGGS--------------------------------------------------
                                                                                      
 
Q9NQI0|DDX4_HUMAN         ------GYRDGNNSEASGPYRRGGRGSFRGCRGGFG-LGSPNNDLDPDECMQRTGGLFGS
sp|Q61496|DDX4_MOUSE      ------GCQDGNDSEASGPFRRGGRGSFRGCRGGFG-LGRPNSESDQDQGTQRGGGLFGS
sp|P34689|GLH1_CAEEL      ---GFGEGGHGGGERNNNCFNCQQPGHRSSDCPEPRKEREPRVCYNCQQPGHTSRECTEE
sp|Q966L9|GLH2_CAEEL      NGFGSGGGGQDRGERNNNCFNCQQPGHRSNDCPEPKKEREPRVCYNCQQPGHNSRDCPEE
sp|O01836|GLH3_CAEEL      ------RAVTRGSKRTSNVKENEGSIHRSDDQVSTENCSAKDEERDRDSGGVSSYGNKRS
P09052|VASA_DROME         ------RGGQGGS--------RGGQGGFRGGEGGFRGRLYENEDGDERRGRLDREERGGE
                                      .                .               :             .
 
Q9NQI0|DDX4_HUMAN         RRPVLSGTGNGDTSQSRSG-----------------------------------------
sp|Q61496|DDX4_MOUSE      RKPAASDSGNGDTYQSRSG-----------------------------------------
sp|P34689|GLH1_CAEEL      RKPREGRTGGFGGGAGFGN-----------------------------------------
sp|Q966L9|GLH2_CAEEL      RKPREGRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSG
sp|O01836|GLH3_CAEEL      DEFCGTSPILEAKGFGISN-----------------------------------------
P09052|VASA_DROME         RRGRLDREERGGERGERGD-----------------------------------------
                           .               ..                                         
 
Q9NQI0|DDX4_HUMAN         ------------------------------------------------------------
sp|Q61496|DDX4_MOUSE      ------------------------------------------------------------
sp|P34689|GLH1_CAEEL      ------------------------------------------------------------
sp|Q966L9|GLH2_CAEEL      GGGQDRGERNNNCFNCQQPGHRSNDCPEPKKEREPRVCYNCQQPGHNSRDCPEERKPREG
sp|O01836|GLH3_CAEEL      ------------------------------------------------------------
P09052|VASA_DROME         ------------------------------------------------------------
                                                                                      
 
Q9NQI0|DDX4_HUMAN         --------------------------------------------SGSERGGYKGLNEEVI
sp|Q61496|DDX4_MOUSE      --------------------------------------------SG--RGGYKGLNEEVV
sp|P34689|GLH1_CAEEL      -----------NGGNDGFGGDGGFGGGEERGPMKCFNCKGEGHRSAECPEPPRGCFNCGE
sp|Q966L9|GLH2_CAEEL      RNGFTSGFGGGNDGGFGGGNAEGFGNNEERGPMKCFNCKGEGHRSAECPEPPRGCFNCGE
sp|O01836|GLH3_CAEEL      ---------------------------------TCFNCKKYGHRATECSAPQRECANCGD
P09052|VASA_DROME         --------------------------------------------GGFAR-----------
                                                                      .               
 

Q9NQI0|DDX4_HUMAN         TGSGKNSWKSEAEGGESSDTQGPKVTYIPPPPPEDEDSIFAH-YQTGINFDKYDTILVEV
sp|Q61496|DDX4_MOUSE      TGSGKNSWKSETEGGESSDSQGPKVTYIPPPPPEDEDSIFAH-YQTGINFDKYDTILVEV
sp|P34689|GLH1_CAEEL      QGHRSNECPNPAKPREGVEGEGPKATYVPVEDNMEDVFNMQK-ISEGLMFNKFFDAEVKL
sp|Q966L9|GLH2_CAEEL      QGHRSNECPNPAKPREGAEGEGPKATYVPVEDNMEEVFNMQK-ISEGLMFNKFFDAEVKI
sp|O01836|GLH3_CAEEL      PNHRANECASWSK---NGVQEPTKVTYVPVVDKMEEVFSMLK-INAGDFFDKFFDASVQL
P09052|VASA_DROME         --RRRNEDDINNNNNIVEDVERKREFYIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKV
                               *.     :       :  :  *:*     :    :      *  *.*:    *::
 
Q9NQI0|DDX4_HUMAN         SGHDAPP---AILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTG
sp|Q61496|DDX4_MOUSE      SGHDAPP---AILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTG
sp|P34689|GLH1_CAEEL      TSSEKTVGIKPCKTFAEANLTETMQKNVAHAGYSKTTPIQQYALPLVHQGYDIMACAQTG
sp|Q966L9|GLH2_CAEEL      TSDKKPVGVKTCKTFSEANLGETMKKNVAHAGYTKTTPIQQYTLPLIHQGHDIMACAQTG
sp|O01836|GLH3_CAEEL      VSRGQPVTIQPCKSFSDSDIPQSMRRNVERAGYTRTTPIQQYTLPLVADGKDILACAQTG
P09052|VASA_DROME         TGSDVPQ---PIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTG
                           .   .    .   * .::: : :  *: ::**.  **:*: ::*::  * *::******
 
Q9NQI0|DDX4_HUMAN         SGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVR
sp|Q61496|DDX4_MOUSE      SGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTRELINQIYLEARKFSFGTCVR
sp|P34689|GLH1_CAEEL      SGKTAAFLLPIMTRLIDDNNLNTAGEGGCYPRCIILTPTRELADQIYNEGRKFAYQTMME
sp|Q966L9|GLH2_CAEEL      SGKTAAFLLPIMARLIDENDLNTAGEGGCYPRCIILTPTRELTDQIYNEGRKFAYQTMME
sp|O01836|GLH3_CAEEL      SGKTAAFLLPIMSRLILEKDLNYGAEGGCYPRCIILTPTRELADQIYNEGRKFSYQSVME
P09052|VASA_DROME         SGKTAAFLLPILSKLLED----PHELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLK
                          ***********::::: :            *. :*::*****  **: *.***:: : :.
 
Q9NQI0|DDX4_HUMAN         AVVIYGGTQLGHSIRQIVQGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLD-M
sp|Q61496|DDX4_MOUSE      AVVIYGGTQFGHSVRQIVQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLD-M
sp|P34689|GLH1_CAEEL      IKPVYGGLAVGYNKGQIEKGATIIVGTVGRIKHFCEEGTIKLDKCRFFVLDEADRMIDAM
sp|Q966L9|GLH2_CAEEL      IRPVYGGLAVGYNKGQIEKGATIIVGTVGRIKHFCEEGTIKLDKCRFFVLDEADRMIDAM
sp|O01836|GLH3_CAEEL      IKPVYGGINVGYNKSQIMKGCTIIVGTIGRVKHFCEDGAIKLDKCRYLVLDEADRMIDSM
P09052|VASA_DROME         IGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLD-M
                             :***  . :.   * :*. :: .* **: .:     * :.. ::.********:* *
 
Q9NQI0|DDX4_HUMAN         GFGPEMKKLISCPGMPSKEQRQTLMFSATFPEEIQRLAAEFLKSNYLFVAVGQVGGACRD
sp|Q61496|DDX4_MOUSE      GFGPEMKKLISCPGMPSKEQRQTLLFSATFPEEIQRLAGDFLKSSYLFVAVGQVGGACRD
sp|P34689|GLH1_CAEEL      GFGTDIETIVNYDSMPRKENRQTLMFSATFPDSVQEAARAFLRENYVMIAIDKIGAANKC
sp|Q966L9|GLH2_CAEEL      GFGTDIDTIVNYESMPKKENRQTLMFSATFPDSVQEAARNHLKEGYIMLAIDKIGAANKC
sp|O01836|GLH3_CAEEL      GFGPEIEQIINYKNMPKNDKRQTMMFSATFPSSVQEAARKLLREDYTMITIDKIGAANKC
P09052|VASA_DROME         GFSEDMRRIMTHVTMR--PEHQTLMFSATFPEEIQRMAGEFLKN-YVFVAIGIVGGACSD
                          **. ::  ::.   *    ::**::******..:*. *   *:. * ::::. :*.*   
 
Q9NQI0|DDX4_HUMAN         VQQTVLQVGQFSKREKLVEILRNIGD------------ERTMVFVETKKKADFIATFLCQ
sp|Q61496|DDX4_MOUSE      VQQTILQVGQYSKREKLVEILRNIGD------------ERTMVFVETKKKADFIATFLCQ
sp|P34689|GLH1_CAEEL      VLQEFERCERSEKKDKLLELLGIDIDSYTTEKSAEVYTKKTMVFVSQRAMADTLASILSS
sp|Q966L9|GLH2_CAEEL      VLQEFEKCDRSEKKDKLLEILGIDIDSYTTEKNSEVYTKKTIVFVSQRAMADTLASILSS
sp|O01836|GLH3_CAEEL      VIQEFELCDRTSKVDKLLKLLGIDIDTYTTEKNSDVFVKKTIVFVAQQKMADTLASIMSA
P09052|VASA_DROME         VKQTIYEVNKYAKRSKLIEILSEQAD------------G-TIVFVETKRGADFLASFLSE
                          * * .    :  * .**:::*    *              *:***  :  ** :*:::. 
 
Q9NQI0|DDX4_HUMAN         EKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTID
sp|Q61496|DDX4_MOUSE      EKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTID
sp|P34689|GLH1_CAEEL      AQVPAITIHGAREQRERSEALRQFRNGSKPVLIATAVAERGLDIKGVDHVINYDMPDNID
sp|Q966L9|GLH2_CAEEL      AQVPAITIHGAREQRERSEALRQFRNGSKPVLIATAVAERGLDIKGVDHVINYDMPDNID
sp|O01836|GLH3_CAEEL      AQVPAITIHGAREQKERSAALKLFRSGAKPVLIATAVVERGLDIKGVDHVINYDMPNNID
P09052|VASA_DROME         KEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKID
                           :..: :*** * * :*. **  *: *   **:**:*. *****:.:.****:*:*..**
 
Q9NQI0|DDX4_HUMAN         EYVHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPG
sp|Q61496|DDX4_MOUSE      EYVHRIGRTGRCGNTGRAISFFDTDSDNHLAQPLVKVLSDAQQDVPAWLEEIAFSTYVPP
sp|P34689|GLH1_CAEEL      DYIHRIGRTGRVGNSGRATSFIS--EDCSLLSELVGVLADAQQIVPDWMQGAAGGNYGAS
sp|Q966L9|GLH2_CAEEL      DYIHRIGRTGRVGNAGRATSFIS--EDCNLLSELVRVLSDADQLVPEWMQGASGGNFGAS
sp|O01836|GLH3_CAEEL      DYIHRIGRTGRVGNSGRATSFISLADDVQILPQLVRTLADAEQVVPSWMKEAAGGTSNPN
P09052|VASA_DROME         DYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFLRTCGAG-----
                          :*:******** ** *** **:.  .*  :   **  * .: * ** ::.  . .     
 
Q9NQI0|DDX4_HUMAN         --FSGSTRGNVFASVDTRK---GKSTLNTAGFSSSQAPNPVDDESWD
sp|Q61496|DDX4_MOUSE      SFSSSTRGGAVFASVDTRKNYQGKHTLNTAGISSSQAPNPVDDESWD
sp|P34689|GLH1_CAEEL      -----------------------------GFGSSVPTQVPQDEEGW-
sp|Q966L9|GLH2_CAEEL      -----------------------------FGFESSVPTQKQDEDCW-
sp|O01836|GLH3_CAEEL      -----------------------------KFEKSIDTEEPEEAW---
P09052|VASA_DROME         --GDGGYSNQNFGGVDVRG----------RGNYVGDATNVEEEEQWD
                                                              .    :