S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Sub2p
YDL084W
UAP56
C26D10.2 / hel-1
UAP56
CG7269 / Hel25E
UAP56
BAt1, Bat1A
UAP56
BAt1
Database Links
Protein DDX39 DDX39
Database Links
Cellular Function
  • pre-mRNA splicing
  • RNA export

Group Alignment

sp|O00148|DDX39_HUMAN      MAEQDVENDLLDYDEEEE------------------PQAPQ-ESTPAPPK
Q8VDW0|DDX39_MOUSE         MAEQDVENELLDYDEDEE------------------PQAPQ-ESTPAPPK
sp|Q07478|SUB2_YEAST       -MSHEGEEDLLEYSDNEQEIQIDASKAAEAGETGAATSATEGDNNNNTAA
sp|Q18212|UAP56_CAEEL      ----MEEEQLLDYEEEQE------------------EIQDKQPEVGGGDA
sp|Q27268|UAP56_DROME      ---MADNDDLLDYEDEEQ------------------TETTAVENQEAP-K
Q13838|UAP56_HUMAN         MAENDVDNELLDYEDDEV------------------ETAAGGDGAEAPAK
                                 :::**:*.:::                                 
 
sp|O00148|DDX39_HUMAN      KDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILG
Q8VDW0|DDX39_MOUSE         KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILG
sp|Q07478|SUB2_YEAST       GDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHG
sp|Q18212|UAP56_CAEEL      RKTKGTYASIHSSGFRDFLLKPEILRAIGDCGFEHPSEVQHECIPQAILG
sp|Q27268|UAP56_DROME      KDVKGTYVSIHSSGFRDFLLKPEILRAIVDCGFEHPSEVQHECIPQAVLG
Q13838|UAP56_HUMAN         KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILG
                            . **:*..***:**:*******: *** ***********:. ***:: *
 
sp|O00148|DDX39_HUMAN      MDVLCQAKSGMGKTAVFVLATLQQIEPVNG-QVTVLVMCHTRELAFQISK
Q8VDW0|DDX39_MOUSE         MDVLCQAKSGMGKTAVFVLATLQQIEPVNG-QVSVLVMCHTRELAFQISK
sp|Q07478|SUB2_YEAST       TDVLCQAKSGLGKTAVFVLSTLQQLDPVPG-EVAVVVICNARELAYQIRN
sp|Q18212|UAP56_CAEEL      MDVVCQAKSGMGKTAVFVITTLQQLEPVDG-EVSVVCMCHTRELAFQISK
sp|Q27268|UAP56_DROME      MDILCQAKSGMGKTAVFVLATLQQLEPSDNNTCHVLVMCHTRELAFQISK
Q13838|UAP56_HUMAN         MDVLCQAKSGMGKTAVFVLATLQQLEPVTG-QVSVLVMCHTRELAFQISK
                            *::******:*******::****::*  .    *: :*::****:** :
 
sp|O00148|DDX39_HUMAN      EYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKN--CPHVVVGTPGRILAL
Q8VDW0|DDX39_MOUSE         EYERFSKYMPSVKVSVFFGGLSIKKDEDVLKKN--CPHVVVGTPGRILAL
sp|Q07478|SUB2_YEAST       EYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKDTAPHIVVATPGRLKAL
sp|Q18212|UAP56_CAEEL      EYERFSKYLPGVKVAVFFGGMAIKKDEERLAND--CPHIVVGTPGRMLAL
sp|Q27268|UAP56_DROME      EYERFSKYMPTVKVAVFFGGMAIQKDEETLKSG--TPHIVVGTPGRILAL
Q13838|UAP56_HUMAN         EYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKN--CPHIVVGTPGRILAL
                           ** *****:* **.:**:** .*.** : * .    **:**.****: **
 
sp|O00148|DDX39_HUMAN      VRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSA
Q8VDW0|DDX39_MOUSE         VRSRSLNLRNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSA
sp|Q07478|SUB2_YEAST       VREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSA
sp|Q18212|UAP56_CAEEL      ARSGKLKLDKVKYFVLDECDKMIGDADMRRDVQEIVKMTPQQKQVMMFSA
sp|Q27268|UAP56_DROME      IRNKKLNLKLLKHFVLDECDKMLEQLDMRRDVQEIFRSTPHGKQVMMFSA
Q13838|UAP56_HUMAN         ARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSA
                            *.  :.*  :* *::*****:: : *********.: **: ** *****
 
sp|O00148|DDX39_HUMAN      TLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLF
Q8VDW0|DDX39_MOUSE         TLSKEIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLF
sp|Q07478|SUB2_YEAST       TLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLA
sp|Q18212|UAP56_CAEEL      TLPKELRTVCKRFMQDPMEVYVDDEAKLTLHGLQQHYVKLKEAEKNRRLL
sp|Q27268|UAP56_DROME      TLSKDIRPVCKKFMQDPMEVYVDDEAKLTLHGLQQHYVNLKENEKNKKLF
Q13838|UAP56_HUMAN         TLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLF
                           **.:::*.:*::*:*:*:*::****:*********:*::*:: ***::* 
 
sp|O00148|DDX39_HUMAN      DLLDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSR
Q8VDW0|DDX39_MOUSE         DLLDVLEFNQVVIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSR
sp|Q07478|SUB2_YEAST       QLLDDLEFNQVIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIAR
sp|Q18212|UAP56_CAEEL      NLLDALEFNQVVIFVKAVKRCEALHQLLTEQNFPSIAIHRQMAQEERLSR
sp|Q27268|UAP56_DROME      ELLDVLEFNQVVIFVKSVQRCVALSQLLTEQNFPAIGIHRGMTQEERLNR
Q13838|UAP56_HUMAN         DLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSR
                           :*** ******:****:. *.  * :**  .***:* :*  * ****: *
 
sp|O00148|DDX39_HUMAN      YQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAG
Q8VDW0|DDX39_MOUSE         YQQFKDFQRRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAG
sp|Q07478|SUB2_YEAST       YKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAG
sp|Q18212|UAP56_CAEEL      YQAFKDFQKRILVATDLFGRGMDIERVNIVFNYDMPEDSDSYLHRVARAG
sp|Q27268|UAP56_DROME      YQQFKDFQKRILVATNLFGRGMDIERVNIVFNYDMPEDSDTYLHRVARAG
Q13838|UAP56_HUMAN         YQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAG
                           *: ****::** *:*::****:****:*:.:***:.:::* *****.***
 
sp|O00148|DDX39_HUMAN      RFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELP-EEIDISTYIEQSR
Q8VDW0|DDX39_MOUSE         RFGTKGLAVTFVSDENDAKILNDVQDRFEVNVAELP-EEIDISTYIEQSR
sp|Q07478|SUB2_YEAST       RFGTKGLAISFVSSKEDEEVLAKIQERFDVKIAEFPEEGIDPSTYLNN--
sp|Q18212|UAP56_CAEEL      RFGTKGLAITFVSDENDAKTLNSVQDRFDISITELP-EKIDVSTYIEGRT
sp|Q27268|UAP56_DROME      RFGTKGLAITFVSDENDAKILNEVQDRFDVNISELP-EEIDLSTYIEGR-
Q13838|UAP56_HUMAN         RFGTKGLAITFVSDENDAKILNDVQDRFEVNISELP-DEIDISSYIEQTR
                           ********::***.::* : * .:*:**::.::*:* : ** *:*::   
 
sp|O00148|DDX39_HUMAN      -
Q8VDW0|DDX39_MOUSE         -
sp|Q07478|SUB2_YEAST       -
sp|Q18212|UAP56_CAEEL      N
sp|Q27268|UAP56_DROME      -
Q13838|UAP56_HUMAN         -