S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Spb4p
YFL002C
DDX55
ZK512.2
DDX55
CG9630
DDX55 DDX55
Database Links
Cellular Function Ribosome Biogenesis

Group Alignment

gi|20987604|H.S._DDX55      -MEHVTEGSWESLPVP-LHPQVLGALRELGFPYMTPVQSATIPLFMRNKD

gi|26329441|M.M._DDX55      -MEHVTEGAWESLQVP-LHPRVLGALRELGFPHMTPVQSATIPLFMKNKD

gi|21355559|D.M._SPB4       ----MSRKKWSSLDKPPLSDAVLQVVQSFGFQQMTPVQTAAIPLLLARKD

gi|3881691|C.e._SPB4        MTSKVGPVALKTFREK-LGPELLEVFDKS-YKSFTDVQVLSGTHLLNLSD

gi|14318521|S.c._SPB4_      ---MSKSLEWDNLGFS-LLPWIRTGLDVMGFETMTPVQASTIPMLAGNKD

                                      ..:    *   :   .    :  :* **  : . :   .*

 

gi|20987604|H.S._DDX55      VAAEAVTGSGKTLAFVIPILEILLRR---EEKLKKSQVGAIIITPTRELA

gi|26329441|M.M._DDX55      VAAEAVTGSGKTLAFVIPILEILLRR---EEKLKKNQVGAIVITPTRELA

gi|21355559|D.M._SPB4       VSAEAVTGSGKTLAFLVPMLEILQRRHK-ETPWGPKEIGALVISPTRELA

gi|3881691|C.e._SPB4        VVVESPTGSGKTLAFVLPMMRMIQNA-----KLQPADIGALILSPSRELC

gi|14318521|S.c._SPB4_      VVVDSVTGSGKTAAFVIPVLEKVVKEEANTSKFKKAHFHSLIIAPTRELS

                            * .:: ****** **::*::. : .           .. :::::*:***.

 

gi|20987604|H.S._DDX55      IQIDEVLSHFTKH----FPEFSQILWIGG--RNPGEDVERFKQQGGNIIV

gi|26329441|M.M._DDX55      IQIDEVLSHFTKH----FPQFSQILWIGG--RNPGEDVERFKQHGGNIIV

gi|21355559|D.M._SPB4       RQISEVLAQFLEHE--DLEHLNQQLIVGG--NSIEEDIATLRRETPCILV

gi|3881691|C.e._SPB4        SQIVSVIQPFAEK-----LNLTVETVTGG--QKVDKNIKMFKNKNVNILV

gi|14318521|S.c._SPB4_      RQIESVVLSFLEHYPSDLFPIKCQLLVGTNEATVRDDVSNFLRNRPQILI

                             ** .*:  * ::       :.     *    .  .::  : ..   *::

 

gi|20987604|H.S._DDX55      ATPGRLEDLFRRKAEGLDLASCVRSLDVLVLDEADRLLDMGFEASINTIL

gi|26329441|M.M._DDX55      ATPGRLEDMFRRKAEGLDLASCVKSLDVLVLDEADRLLDMGFEASINTIL

gi|21355559|D.M._SPB4       CTPGRLEDLFQRKGDDLNLAAQVKSLEFLVLDEADRLLDLGFKTSVNNIL

gi|3881691|C.e._SPB4        ATPGRLFQIIQH--EKTLIARKMRTLQLLVIDEADRFNEIQFEDHMREIL

gi|14318521|S.c._SPB4_      GTPGRVLDFLQMP------AVKTSACSMVVMDEADRLLDMSFIKDTEKIL

                             ****: ::::        *    : ..:*:*****: :: *    . **

 

gi|20987604|H.S._DDX55      EFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRVSVKEKGVAASSAQKTP

gi|26329441|M.M._DDX55      EFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRISVKEKGVAASSTQKTP

gi|21355559|D.M._SPB4       GYLPRQRRTGLFSATQTTEVTDLIRAGLRNPVLVSVKEK-----ASVNTP

gi|3881691|C.e._SPB4        SCIPKQRRTGLFSATQVKEEDDLMVFGLRNAKQVKVAQE-----RNSAAP

gi|14318521|S.c._SPB4_      RLLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSK-------NQAP

                              :*:**********      ::.  ****.  :.* .:         :*

 

gi|20987604|H.S._DDX55      SRLENYYMVCKADEKFNQLVHFLRN--HKQEKHLVFFSTCACVEYYGKTL

gi|26329441|M.M._DDX55      SRLENHYMICKADEKFNQLVHFLRS--RQQEKHLVFFSTCACVEYYGKAL

gi|21355559|D.M._SPB4       ARLQNFYRIVEPELKFVALLEFLSSPATVIGKVMVFFPTCACVEYWAEAL

gi|3881691|C.e._SPB4        STLKNYYVECRADEKTSVCLEFIRQ--RTDKKILIFFPSCNSVRYFYKIF

gi|14318521|S.c._SPB4_      SSLKLNYCVVNPAEKLQLLVSILNN--YKFKKCIVYFPTCVSVSYFYSFI

                            : *:  *   ..  *    : :: .      * :::*.:* .* *: . :

 

gi|20987604|H.S._DDX55      EVLVKG------VKIMCIHGKMKY-KRNKIFMEFRKLQS-GILVCTDVMA

gi|26329441|M.M._DDX55      EALLKK------VKILCIHGKMKY-KRNKIFMEFRKLQS-GILVCTDVMA

gi|21355559|D.M._SPB4       PPLLPK------RTVLGIHGKMKN-KRANVVEKFRNTPQ-AVLLCTDVLA

gi|3881691|C.e._SPB4        ERCLGK------RPLFAVHGKCSNPHRASQIKAFSDSTN-GVMISTDVMA

gi|14318521|S.c._SPB4_      QYLGKRNILVNEVEIFSLHGKLQTSARTKTLTAFTDSLSNSVLFTTDVAA

                                          :: :*** .   * . .  * .  . .::. *** *

 

gi|20987604|H.S._DDX55      RGIDIPEVNWVLQYDPPSNASAFVHRCGRTARIGHGGSALVFLLPMEESY

gi|26329441|M.M._DDX55      RGIDIPEVNWVLQYDPPSNASAFVHRCGRTARIGHGGSALVFLLPMEEAY

gi|21355559|D.M._SPB4       RGLDVPEIEWVVQWDPPSTASSFVHRVGRTARQGNEGNALVFLLPSEDAY

gi|3881691|C.e._SPB4        RGIDISDIDWVIQFDLPKHSSWFVHRAGRTARCGREGNALILIASEQLAY

gi|14318521|S.c._SPB4_      RGIDIPDVDLVIQLDPPTNTDMFMHRCGRTGRANRVGKAITFLNEGREED

                            **:*:.::: *:* * *. :. *:** ***.* .. *.*: ::   .  

 

gi|20987604|H.S._DDX55      INFLAINQKCPLQEMK---------PQRNTADLLPKLKSMALADRAVFEK

gi|26329441|M.M._DDX55      INFLAINQKCPLQEMS---------LQRNTIDLLPKLRAMALADRAVFEK

gi|21355559|D.M._SPB4       VHFLKINQKVELTKLLTEEAEDADREKKKLPAVLDQLHRLQAADKGVYDK

gi|3881691|C.e._SPB4        VNFLDNHEKVKLDEIKVPTN-----NSRKSEELRQKMIKIQVSDRAILEA

gi|14318521|S.c._SPB4_      FIPFMQVKNVELEELDLEVKG-------ITTNFYEDFRNWILEDRDRFDK

                            .  :   ::  * ::                 .  .:      *:   :

 

gi|20987604|H.S._DDX55      GMKAFVSYVQAYAKHECNLIFRLKDLDFASLARGFALLRMPKMPELRGKQ

gi|26329441|M.M._DDX55      GMKAFVSFVQAYAKHECSLIFRLKDLDFAGLARGFALLRMPRMPELRGKQ

gi|21355559|D.M._SPB4       GMRAFVSHVRAYTKHECSAILRLKDLDLGKMATAYGLLQLPRMPELKNYQ

gi|3881691|C.e._SPB4        GTRAFVSHVESYAKHDCHLICSLDDLNVVGLANSYALLRLPKMRELSQRK

gi|14318521|S.c._SPB4_      GVKAYVAFIKYYSNHSATSIFRLQSLDYVGIAKLYGLFRLPRMPEITKYL

                            * :*:*:.:. *::*..  *  *..*:   :*  :.*:::*:* *:   

 

gi|20987604|H.S._DDX55      FP--------DFVP--VDVNTDTIPFKDKIREKQRQKLLE----------

gi|26329441|M.M._DDX55      FP--------DFVP--VDIDTDTIPFKDKIREKQRQKLLE----------

gi|21355559|D.M._SPB4       GG--------GYVAPAFEVDLSKLTYKNAQKEQVRQKKMETYEQTGSWPG

gi|3881691|C.e._SPB4        DL--------DMFDR-SAIETSEIKYADVKLEANRETVMK----------

gi|14318521|S.c._SPB4_      ATEKQEGIFPGNWLVDPPVNMDEYKYKDKKREKERQETLKN-------IS

                                      .       :: .   : :   *  *:  ::         

 

gi|20987604|H.S._DDX55      -QQRREKTENEGRRKFIKNKAWSKQ---KAKKEKKKKMNEKRKR----EE

gi|26329441|M.M._DDX55      -QKRKERSENEGRKKFIKNKAWSKQ---KAKKERKKKMNAKRKK----DE

gi|21355559|D.M._SPB4       QKQHKKRVESWDQTKKAKLDAKSKKELRKAKKQRKKAAEAEASRSGKGKK

gi|3881691|C.e._SPB4        -EKHEKKVETLAAKDKKRREKEARKLKKMGGRFRNGGGTGRKAEE---KK

gi|14318521|S.c._SPB4_      LINDKKKLKSELKKKNLAWSDKTLTKERKLERKEKMSLKRKAIEEELKAE

                              : .:: :.    .    .  :        : .:     .  .     :

 

gi|20987604|H.S._DDX55      GSDIEDEDMEELLNDTRLLKKLKKGKITEEEFEKGLLTTGKRTIKTVDLG

gi|26329441|M.M._DDX55      GSDIDDEDMEELLNDTRLLKKFKKGKITEEEFEKGLLTSAKRTVQLTDLG

gi|21355559|D.M._SPB4       RQQFSQEDLDELASDIRLFKRLKKNKISEEDFDKAMGIEGNND-------

gi|3881691|C.e._SPB4        ALKRKAEEEDDAQNDIRLLKRIKRGKLSKKEIKDVL--------------

gi|14318521|S.c._SPB4_      ELDENAEEERIKEDWKEIVLQNKRKKVSSKAIQGNFDDL-----------

                              . . *:     .  .:. : *: *::.: :.  :             

 

gi|20987604|H.S._DDX55      ISDLEDGC

gi|26329441|M.M._DDX55      VSDLEEDS

gi|21355559|D.M._SPB4       --------

gi|3881691|C.e._SPB4        --------

gi|14318521|S.c._SPB4_      --------