S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Rrp3p
YHR065C
DDX47
T26G10.1

CG9253
DDX47 DDX47
Database Links
Cellular Function Ribosome Biogenesis

Group Alignment

gi|52782790|M.M._DDX47      --------------------------------MAADEEPDSPSG------

gi|52782792|H.S._DDX47      --------------------------------MAAPEEHDSPTE------

gi|7298752|D.M._RRP3        --------------------MSETSEDEQTQLQTSDEEEDLGSEEEQEDE

gi|3880293|C.E._RRP3        ------------------MSDSSSSDGEDNQKFLGNRKKNLTKKKVVT--

gi|37362659|S.C._RRP3       MSKIVKRKEKKANDELTSLAEKIRAKALENQKKLIEAEKEGGSESDSEED

                                                                 : :  .      

 

gi|52782790|M.M._DDX47      -------------------ALQTAAEEEETKTFKDLGVTDVLCEACDQLG

gi|52782792|H.S._DDX47      -------------------ASQPIVEEEETKTFKDLGVTDVLCEACDQLG

gi|7298752|D.M._RRP3        DNNHKEGDSEAALSGEDDKGSEDDAAEEQKLTWKDLGLNEALCQACDELK

gi|3880293|C.E._RRP3        -----------------EEIEKDDEEDVKEKSFAELGVSQPLCDACQRLG

gi|37362659|S.C._RRP3       ATAEKKKVLKSKSKSTVSTQNENTNEDESFESFSELNLVPELIQACKNLN

                                                 :    : .  :: :*.:   * :**..*

 

gi|52782790|M.M._DDX47      WAKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRL

gi|52782792|H.S._DDX47      WTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRL

gi|7298752|D.M._RRP3        WKAPSKIQREAIPVALQGKDVIGLAETGSGKTGAFALPILHALLENPQRY

gi|3880293|C.E._RRP3        WMKPSKIQQAALPHALQGKDVIGLAETGSGKTGAFAIPVLQSLLDHPQAF

gi|37362659|S.C._RRP3       YSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIPILNRLWHDQEPY

                            :  *: **  *:* **:*:*:****:******.***:*:*: * .  : 

 

gi|52782790|M.M._DDX47      FALVLTPTRELAFQISEQFEALGSSIGVQCAVIVGGIDSMSQSLALAKKP

gi|52782792|H.S._DDX47      FALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQSLALAKKP

gi|7298752|D.M._RRP3        FALVLTPTRELAFQIGEQFEALGSGIGIKCCVVVGGMDMVAQGLQLAKKP

gi|3880293|C.E._RRP3        FCLVLTPTRELAFQIGQQFEALGSGIGLIAAVIVGGVDMAAQAMALARRP

gi|37362659|S.C._RRP3       YACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKP

                            :. :*:****** ** : *::*** :*: .  :***::   *.  * ::*

 

gi|52782790|M.M._DDX47      HIVIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILK

gi|52782792|H.S._DDX47      HIIIATPGRLIDHLENTKGFNLRALKYLVMDEADRILNMDFETEVDKILK

gi|7298752|D.M._RRP3        HIIIATPGRLVDHLENMKGFNLKAIKYLVMDEADRILNMDFEVELDKILK

gi|3880293|C.E._RRP3        HIIVATPGRLVDHLENTKGFNLKALKFLIMDEADRILNMDFEVELDKILK

gi|37362659|S.C._RRP3       HIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILK

                            **::******:***** ***.*: :*:*:******:*:*:*   :*:***

 

gi|52782790|M.M._DDX47      VIP-RDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKLQQYY

gi|52782792|H.S._DDX47      VIP-RDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKLQQYY

gi|7298752|D.M._RRP3        VLP-RERRTFLFSATMTKKVKKLQRASLKDPVKVEVSNKYQTVEQLQQSY

gi|3880293|C.E._RRP3        VIP-RERRTYLFSATMTKKVSKLERASLRDPARVSVSSRYKTVDNLKQHY

gi|37362659|S.C._RRP3       IIPTQERTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTL

                            ::* ::* *:*******.*:.**:**:* :*.:  **.:*:**: * * 

 

gi|52782790|M.M._DDX47      LFIPSKFKDTYLVYILNELAGNSFMIFCSTCNNTQRTALLLRNLGFTAIP

gi|52782792|H.S._DDX47      IFIPSKFKDTYLVYILNELAGNSFMIFCSTCNNTQRTALLLRNLGFTAIP

gi|7298752|D.M._RRP3        LFIPVKYKDVYLVHILNELAGNSFMIFCSTCNNTVKTALMLRALGLAAIP

gi|3880293|C.E._RRP3        IFVPNKYKETYLVYLLNEHAGNSAIVFCATCATTMQIAVMLRQLGMQAVP

gi|37362659|S.C._RRP3       MVVPGGLKNTYLIYLLNEFIGKTMIIFTRTKANAERLSGLCNLLEFSATA

                            :.:*   *:.**:::***  *:: ::*  *  .: : : : . * : * .

 

gi|52782790|M.M._DDX47      LHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPT

gi|52782792|H.S._DDX47      LHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPT

gi|7298752|D.M._RRP3        LHGQMSQNKRLAALNKFKAKNRSILISTDVASRGLDIPHVDVVVNFDIPT

gi|3880293|C.E._RRP3        LHGQMSQEKRLGSLNKFKSKAREILVCTDVAARGLDIPHVDMVINYDMPS

gi|37362659|S.C._RRP3       LHGDLNQNQRMGSLDLFKAGKRSILVATDVAARGLDIPSVDIVVNYDIPV

                            ***::.*.:*:.:*: **:  *.**:.****:****** **:*:*:*:*

 

gi|52782790|M.M._DDX47      HSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPVFPTQ

gi|52782792|H.S._DDX47      HSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQ

gi|7298752|D.M._RRP3        HSKDYIHRVGRTARAGRSGKAITLVSQYDIELYQRIEHLLGKQLTLYKCE

gi|3880293|C.E._RRP3        QSKDYVHRVGRTARAGRSGIAITVVTQYDVEAYQKIEANLGKKLDEYKCV

gi|37362659|S.C._RRP3       DSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKLPKESVD

                            .**.*:************* :*:.*:***:*   :**  :**:*     

 

gi|52782790|M.M._DDX47      DEEVMMLTERVNEAQRFARMELREHGEKK--KRKREDAGDDDDKEGAIG-

gi|52782792|H.S._DDX47      DDEVMMLTERVAEAQRFARMELREHGEKK--KRSREDAGDNDDTEGAIG-

gi|7298752|D.M._RRP3        EDEVMALQERVAEAQRTAKLELKDLEDTR--GGHKRGGDTHDDSENFTG-

gi|3880293|C.E._RRP3        ENEVMVLVERTQEATENARIEMKEMDEKKKSGKKRRQNDDFGDTEESGGR

gi|37362659|S.C._RRP3       KNIILTLRDSVDKANGEVVMEMNRRNKEKIARGKGRRGRMMTRENMDMG-

                            .: :: * : . :*   . :*:.   . :      .        :   *

 

gi|52782790|M.M._DDX47      VRN--KVAG----------GKMKKRKGR---

gi|52782792|H.S._DDX47      VRN--KVAG----------GKMKKRKGR---

gi|7298752|D.M._RRP3        ARKRMKPMGGTGGGGRKSFGKKNWSKGKQKR

gi|3880293|C.E._RRP3        FKMGIKSMGGRGGSG----GGRGGKKKKMSK

gi|37362659|S.C._RRP3       ER-----------------------------

                             :