S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Rok1p
YGL171W
R05D11.4 CG5589 DDX52 DDX52
Database Links
Cellular Function Ribosome Biogenesis

Group Alignment

gi|56206921|MM_DDX52_ROK1          MDSYDLFRRLGAGAKFDVKRFSADATRFQVGKRKFDSESLEVLKGLDFFG

gi|34582345|HS_DDX52_ROK1          MDVHDLFRRLGAGAKFDTRRFSADAARFQIGKRKYDFDSSEVLQGLDFFG

gi|24666101|DM_CG5589-PA_ROK1      MDEHDIFKLITAGVRFTK-------------KSKKEPSSKQQLQPLP---

gi|1173121|SC_ROK1                 ---MDIFRVLTRGASVKKE-----------SGPKAKAADYSVINGND---

gi|3878881|CE_R05D11.4_ROK1        --MSLAFRTLSFGIKRSQP-------------KKKDADDLNKKKELS---

                                         *: :  *                    * .  . .  :     

 

gi|56206921|MM_DDX52_ROK1          NKKSVSDECGALQIHQEPPNEEKTQGVLLERSKEPKKKKRKKMTSEVPAQ

gi|34582345|HS_DDX52_ROK1          NKKSVPGVCGASQTHQKPQNGEKKEESLTERKREQSKKKRKTMTSEIASQ

gi|24666101|DM_CG5589-PA_ROK1      ----------EVSKHEEPVKSEESD------KDDEDITEFRLLDGDSSNQ

gi|1173121|SC_ROK1                 ------------ENHKEDNNESQIVKELDFFRNKRIISKVEDDREKTTEN

gi|3878881|CE_R05D11.4_ROK1        -------TITEESLRRYDELREKMIGKVESKIEKKVKKNKKKASIEILAS

                                               . :.     .:          .   .: .    .   .

 

gi|56206921|MM_DDX52_ROK1          EDFDGGIQWTSSVEAKLQDEKVSGEKKLTSGKLEHLRK-EKVNFFRNKHK

gi|34582345|HS_DDX52_ROK1          EE-GATIQWMSSVEAKIEDKKVQRESKLTSGKLENLRK-EKINFLRNKHK

gi|24666101|DM_CG5589-PA_ROK1      PK----------------RKKPKKEKTLSPKELEIQKAAEEANETRKQYG

gi|1173121|SC_ROK1                 DS----------------PNKEEKSGNDDGLIKPVITNTVEASALRKSYK

gi|3878881|CE_R05D11.4_ROK1        RK------------RVHDSDGDSENEVEETVGDVEKRMQKLLDDIRRTNR

                                    .                 .  . .                 .  *.  

 

gi|56206921|MM_DDX52_ROK1          IHVQGTDLPDPIATFQQLDQEYKINSRLLQNILDAGFQVPTPIQMQAIPV

gi|34582345|HS_DDX52_ROK1          IHVQGTDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPV

gi|24666101|DM_CG5589-PA_ROK1      IRVLGKNVPPPVDSFGTLTRDFKMLPRLQQNLLSRNFDHPTPIQMQALPV

gi|1173121|SC_ROK1                 GNVSGIDIPLPIGSFEDLISRFSFDKRLLNNLIENGFTEPTPIQCECIPV

gi|3878881|CE_R05D11.4_ROK1        IFTWGDHLPNIILRFS----DSSMSPSLLNRLSENSIRQPSPIQMQSIPF

                                     . * .:*  :  *       .:   * :.: . .:  *:*** :.:*.

 

gi|56206921|MM_DDX52_ROK1          MLHGRELLASAPTGSGKTLAFSIPILMQLKQPT---------NKGFRALV

gi|34582345|HS_DDX52_ROK1          MLHGRELLASAPTGSGKTLAFSIPILMQLKQPA---------NKGFRALI

gi|24666101|DM_CG5589-PA_ROK1      LLQRRALMACAPTGSGKTLAFLTPIINGLRAHK---------TTGLRALV

gi|1173121|SC_ROK1                 ALNNRDVLACGPTGSGKTLAFLIPLVQQIIDDKQ--------TAGLKGLI

gi|3878881|CE_R05D11.4_ROK1        MTERRNVLASAPTGSGKTLAFALPVIDEILELKQRADYSSSNSSKLLAVV

                                     . * ::*..**********  *::  :             .  : .::

 

gi|56206921|MM_DDX52_ROK1          ISPTRELASQIHRELIKIS------EGTGFRIHMIHKAAIAAKKFGPKSS

gi|34582345|HS_DDX52_ROK1          ISPTRELASQIHRELIKIS------EGTGFRIHMIHKAAVAAKKFGPKSS

gi|24666101|DM_CG5589-PA_ROK1      LAPTRELAQQIYRECAELT------RETGLRTHFISKVSEAKQKHGAECK

gi|1173121|SC_ROK1                 ISPTKELANQIFIECFKLSYKIFLEKKRPLQVALLSKSLGAKLKNKVVSD

gi|3878881|CE_R05D11.4_ROK1        LEPTRELAAQTYTEFLKYCAN--------------TSISAANFSGEETDI

                                   : **:*** * . *  :                   .   *  .     

 

gi|56206921|MM_DDX52_ROK1          KKFDILVTTPNRLIYLLKQDPPGIDLTNVEWLVVDESDKLFEDGK---TG

gi|34582345|HS_DDX52_ROK1          KKFDILVTTPNRLIYLLKQDPPGIDLASVEWLVVDESDKLFEDGK---TG

gi|24666101|DM_CG5589-PA_ROK1      QRYDILVSTPNRVRFLLQQEPPLLDLSHVEWFVLDEADRLMEEGQ---NN

gi|1173121|SC_ROK1                 KKYDIIISTPLRLIDVVKNEA--LDLSKVKHLIFDEADKLFD------KT

gi|3878881|CE_R05D11.4_ROK1        QHADILVSTPNRIVFHL----DKIDTSSLRWLVVDESDRLFEVVEGQDKC

                                   :: **:::** *:   :      :* : :. ::.**:*:*::      .

 

gi|56206921|MM_DDX52_ROK1          FREQLASIFLACTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVSIGARN

gi|34582345|HS_DDX52_ROK1          FRDQLASIFLACTSHKVRRAMFSATFAYDVEQWCKLNLDNVISVSIGARN

gi|24666101|DM_CG5589-PA_ROK1      FKEQLDDIYAACSNPTKCVAFFSATYTVPVAKWALRHLKNLVRITIGVQN

gi|1173121|SC_ROK1                 FVEQSDDILSACREPSLRKAMFSATIPSNVEEIAQSIMMDPVRVIIGHKE

gi|3878881|CE_R05D11.4_ROK1        FRNQLAAIYKACDAKCTRVAFFSATFSHEVEKWCKENIDEIGMVCVGERN

                                   * :*   *  **       *:**** .  * : .   : :   : :* ::

 

gi|56206921|MM_DDX52_ROK1          SAVETVEQELLFVGSETGKLLAMRELVKKG-FKPPVLVFVQSIERAKELF

gi|34582345|HS_DDX52_ROK1          SAVETVEQELLFVGSETGKLLAVRELVKKG-FNPPVLVFVQSIERAKELF

gi|24666101|DM_CG5589-PA_ROK1      SATETVQQELLFVGSEGGKLVAIRDLVRQG-LQPPVLVFVQSKERAKQLF

gi|1173121|SC_ROK1                 AANTNIEQKLIFCGNEEGKLIAIRQLVQEGEFKPPIIIFLESITRAKALY

gi|3878881|CE_R05D11.4_ROK1        SSNTSVKQKLTYCGTEDGKKIAIRNLLRTS-FKPPALVFVQSKDRAVQLV

                                   ::  .::*:* : *.* ** :*:*:*:: . ::** ::*::*  **  *

 

gi|56206921|MM_DDX52_ROK1          HEL--IYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGID

gi|34582345|HS_DDX52_ROK1          HEL--IYEGINVDVIHAERTQQQRDNTVHSFRAGKIWVLICTALLARGID

gi|24666101|DM_CG5589-PA_ROK1      EEL--LYDGINVDVIHAERSQHQRDNCVKAFREGSIWVLICTELMGRGID

gi|1173121|SC_ROK1                 HEL--MYDRINVDVIHAERTALQRDRIIERFKTGELWCLICTDVLARGID

gi|3878881|CE_R05D11.4_ROK1        KLLSAIDSNLKVDSINSGKSDKERDETMERFRRGEIWVLVCTELLGRGLD

                                   . *  : . ::** *:: ::  :**. :. *: *.:* *:** ::.**:*

 

gi|56206921|MM_DDX52_ROK1          FKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFFTEDDKPLLRSV

gi|34582345|HS_DDX52_ROK1          FKGVNLVINYDFPTSSVEYIHRIGRTGRAGNKGKAITFFTEDDKPLLRSV

gi|24666101|DM_CG5589-PA_ROK1      FKGVNLVINYDFPPTTISYIHRIGRTGRAGRPGRAITFFTQEDTSNLRGI

gi|1173121|SC_ROK1                 FKGVNLVINYDVPGSSQAYVHRIGRTGRGGRSGKAITFYTKQDSVAIKPI

gi|3878881|CE_R05D11.4_ROK1        LSDVGLVINYDLPTSIVSYIHRVGRTGRAGKSGHAVTYFTDADMKYIKSI

                                   :..*.******.* :   *:**:*****.*. *:*:*::*. *   :: :

 

gi|56206921|MM_DDX52_ROK1          ANVIQQAGCPVPEYIKGFQKLLSKQKK--KMIKKPLERESICTTP-----

gi|34582345|HS_DDX52_ROK1          ANVIQQAGCPVPEYIKGFQKLLSKQKK--KMIKKPLERESISTTP-----

gi|24666101|DM_CG5589-PA_ROK1      ALIIKNSGGTVPEYMLQMKKVRKSEAK--MRAKKPLDREDISTKIRPETK

gi|1173121|SC_ROK1                 INVMKQSGCEVSEWMDKMAKMTRKEKESIKNGKAHKERKQITTVP-----

gi|3878881|CE_R05D11.4_ROK1        ATVIRQSGFDVPEYLMEMKKVSRDRKK--DMLKHAPKRHKIAIVK-----

                                     :::::*  *.*::  : *:  .. :     *   .*..*        

 

gi|56206921|MM_DDX52_ROK1          ----------------KYFLEQAK--QKKVAGQN-------------SKK

gi|34582345|HS_DDX52_ROK1          ----------------KCFLEKAKDKQKKVTGQN-------------SKK

gi|24666101|DM_CG5589-PA_ROK1      GDEKHKSTKLKKVERTEKILKNRKGYEKDLNSKQKKLGNIKTELKPAGKR

gi|1173121|SC_ROK1                 ----------------KMDKAKRRRQQEMIAASK-------------RRK

gi|3878881|CE_R05D11.4_ROK1        ----------------EQVIKKKKMLAKAAAEEKAKN---KTETQTAEKP

                                                   :    : :   :    .:              :

 

gi|56206921|MM_DDX52_ROK1          KETLKEKS---------

gi|34582345|HS_DDX52_ROK1          KVALEDKS---------

gi|24666101|DM_CG5589-PA_ROK1      KGNVEKKTKNKNNQT--

gi|1173121|SC_ROK1                 NEELSKKHFSK------

gi|3878881|CE_R05D11.4_ROK1        EKKIKKKKLIKKNNKNI

                                   :  :..*