S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Prp5p
YBR237W
F53H1.1 CG6227 DDX46 DDX46
Database Links
Cellular Function pre-mRNA splicing pre-mRNA splicing

Group Alignment

gi|62089534|M.M.                    MGRESRHYRKRSASRGRSGSRSRSRSPSDKRSKRGDDRRSRSRD------

gi|41327773|H.S.Prp5-DDX46          MGRESRHYRKRSASRGRSGSRSRSRSPSDKRSKRGDDRRSRSRD------

gi|24642151|D.M._Prp5_-             MSKSSGRDRDRERDRERERERDRERE-RDRDRERDNRHDSRSRDYDMGKS

gi|14574201|C.E._Prp5_-F53H1.1      MGRGEHKEHKRKRSRSKERKRSRSRSPRGSR-------------------

gi|6319714|S.c.Prp5p                ---METIDSKQNINRESLLE------------------------------

                                        .    .:. .*    .                             

 

gi|62089534|M.M.                    ------------RDRRRERSRSRDKRRSRS-RDRKRLRRSRSR--ERDRS

gi|41327773|H.S.Prp5-DDX46          ------------RDRRRERSRSRDKRRSRS-RDRKRLRRSRSR--ERDRS

gi|24642151|D.M._Prp5_-             RNGGGGGAGGGSRNMREDRKRGKDMISDRGKRDDKRRKCSRSKDYEKDNS

gi|14574201|C.E._Prp5_-F53H1.1      -------------EHREHRDRDRD--------------------------

gi|6319714|S.c.Prp5p                --------------------------------------------------

                                                                                      

 

gi|62089534|M.M.                    RERRRS---RSRDRRRSRSRSRGRRSRSSSPGSKTKKTE---NRSRSKEK

gi|41327773|H.S.Prp5-DDX46          RERRRS---RSRDRRRSRSRSRGRRSRSSSPGNKSKKTE---NRSRSKEK

gi|24642151|D.M._Prp5_-             PHYRRLDKDRDRDRDRDRQREKEREREKEKEREKEKERERDKDRERDRQR

gi|14574201|C.E._Prp5_-F53H1.1      ---------RERRRERDTDREKTRDREKQRDAEKKKEKE-------SKTA

gi|6319714|S.c.Prp5p                --------------ERRKKLAKWKQKKAQFDAQKEHQTS-----------

                                                   *  .  : :  . .   .* :: .          

 

gi|62089534|M.M.                    AEGGDSSKEKKKD--------KDDKEDEKEKDAGNFDQNKLEEEMRKRKE

gi|41327773|H.S.Prp5-DDX46          TDGGESSKEKKKD--------KDDKEDEKEKDAGNFDQNKLEEEMRKRKE

gi|24642151|D.M._Prp5_-             EKESDSRRAAAAAPLIIPLLSTSCSEEEVEEIDKEEQQRRLEQEMIKRRE

gi|14574201|C.E._Prp5_-F53H1.1      IFEMEESR--------------NDTEEVMK-----MKEAELLQGVERRRR

gi|6319714|S.c.Prp5p                -----------------------RNDIVTNSLEGKQTTEKFTERQERVKE

                                                            .:   :         .: :   : :.

 

gi|62089534|M.M.                    RVEKWREEQRKKAMENIGELKKEIEEMKQGKKWSLEDDDDDEDD----PA

gi|41327773|H.S.Prp5-DDX46          RVEKWREEQRKKAMENIGELKKEIEEMKQGKKWSLEDDDDDEDD----PA

gi|24642151|D.M._Prp5_-             RIERWRAERKRDTKAAVVAP----SLVNSAKKWSLEDESEEDDSNPAPPL

gi|14574201|C.E._Prp5_-F53H1.1      NVEKWRAQKKKEELDLQSEQS---DEKSEKKPWNLEDEDDEDE------F

gi|6319714|S.c.Prp5p                ELRKRKNEFRKSDEPVSVKPSKKKSKRSKVKKKISFDFSDDDDS------

                                    .:.: : : ::.            .  .. *     * .::::      

 

gi|62089534|M.M.                    EAEKEGTEMED---------------------------------------

gi|41327773|H.S.Prp5-DDX46          EAEKEGNEMEG---------------------------------------

gi|24642151|D.M._Prp5_-             DSGKKDAEPDSPPSKFHSIRKRFDDDVVESKFSPVKRPTFSKSFGKLGIG

gi|14574201|C.E._Prp5_-F53H1.1      DIKNEGISEENP--------------------------------------

gi|6319714|S.c.Prp5p                ---EIGVSFRS---------------------------------------

                                       : . .  .                                      

 

gi|62089534|M.M.                    -----------------------EELDPLDAYMEEVKEEVKKFNMRSVKG

gi|41327773|H.S.Prp5-DDX46          -----------------------EELDPLDAYMEEVKEEVKKFNMRSVKG

gi|24642151|D.M._Prp5_-             LATKAEADIKKEPPPVDTKKEIKKKPEPVAAKMEIVEEPTVAAGEKTKKE

gi|14574201|C.E._Prp5_-F53H1.1      ----------------------VKMEEKVEKMDTDDEEDPLDAFMKEIAT

gi|6319714|S.c.Prp5p                ------------------------KEHIQKAPEHDNEKDPLDEFMTSLKE

                                                              .         ::           

 

gi|62089534|M.M.                    ------GAGNEKKSG-----------------------------------

gi|41327773|H.S.Prp5-DDX46          ------GGGNEKKSG-----------------------------------

gi|24642151|D.M._Prp5_-             PEQPHVGAKSEPEVEDKPQPEAEPEDEIDPLDAYMQEVNNEMRRVNNFVN

gi|14574201|C.E._Prp5_-F53H1.1      --------KNAKKTG-----------------------------------

gi|6319714|S.c.Prp5p                --------------------------------------------------

                                                                                     

 

gi|62089534|M.M.                    -PTVTKVVTVVTTKKAVVDADKKKGELMENDQDAMEYSSEEEEVDLQTAL

gi|41327773|H.S.Prp5-DDX46          -PTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAMEYSSEEEEVDLQTAL

gi|24642151|D.M._Prp5_-             PPAKSQGVVILTGVAKKKTTTLKKGEVIEQNMDSLEYSSEDELEDIRDTA

gi|14574201|C.E._Prp5_-F53H1.1      --NSTQKASGIVTIVQEEKPEPEKGQVLENE-DNMDMVIDD--FDIETAA

gi|6319714|S.c.Prp5p                --EKMSNSKGMYDRGDILDVEDQLFELGGTDDEDVEDNTDN-----SNIA

                                         .    :           :  ::   : : ::   ::        

 

gi|62089534|M.M.                    TGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEM

gi|41327773|H.S.Prp5-DDX46          TGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEM

gi|24642151|D.M._Prp5_-             VNLAMKHRKELAKIDHSSVTYAPFRKNFYVEVPELTRMTAADVEKYRSDL

gi|14574201|C.E._Prp5_-F53H1.1      ASLCHKGR-MLAQTDHSKVYYRKFKKNFYIETEEIRRMTKAEVKAYREEL

gi|6319714|S.c.Prp5p                KIAKLKAKKRVKQIYYSPEELEPFQKNFYIESETVSSMSEMEVEELRLSL

                                         * :  :    :.      *:****:*   :  *:  :*:  * .:

 

gi|62089534|M.M.                    EGITVKGKGCPKPIKSWVQCGISMK-ILNSLKKHGYEKPTPIQTQAIPAI

gi|41327773|H.S.Prp5-DDX46          EGITVKGKGCPKPIKSWVQCGISMK-ILNSLKKHGYEKPTPIQTQAIPAI

gi|24642151|D.M._Prp5_-             EGIQVKGKGCPKPIKTWAQCGVSKK-EMEVLRRLGFEKPTPIQCQAIPAI

gi|14574201|C.E._Prp5_-F53H1.1      DSITVKGIDCPKPIKTWAQCGVNLK-MMNVLKKFEYSKPTSIQAQAIPSI

gi|6319714|S.c.Prp5p                DNIKIKGTGCPKPVTKWSQLGLSTDTMVLITEKLHFGSLTPIQSQALPAI

                                    :.* :** .****:..* * *:. .  :   .:  : . *.** **:*:*

 

gi|62089534|M.M.                    MSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGE-GPIAVIMTPTR

gi|41327773|H.S.Prp5-DDX46          MSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGE-GPIAVIMTPTR

gi|24642151|D.M._Prp5_-             MSGRDLIGIAKTGSGKTLAFILPMFRHILDQPSMEDGD-GAIAIIMAPTR

gi|14574201|C.E._Prp5_-F53H1.1      MSGRDVIGIAKTGSGKTLAFLLPMFRHILDQPELEEGD-GPIAVILAPTR

gi|6319714|S.c.Prp5p                MSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPMGLILAPTR

                                    *****:***:*******::::**::*::  *  :.. : *.:.:*::***

 

gi|62089534|M.M.                    ELALQITKECKKFSKTLG-LRVVCVYGGTGISEQIAELKRGAEIIVCTPG

gi|41327773|H.S.Prp5-DDX46          ELALQITKECKKFSKTLG-LRVVCVYGGTGISEQIAELKRGAEIIVCTPG

gi|24642151|D.M._Prp5_-             ELCMQIGKDIRKFSKSLG-LRPVCVYGGTGISEQIAELKRGAEIIVCTPG

gi|14574201|C.E._Prp5_-F53H1.1      ELAMQTYKEANKFAKPLG-LKVACTYGGVGISEQIADLKRGAEIVVCTPG

gi|6319714|S.c.Prp5p                ELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQITDLKRGTEIVVATPG

                                    **.:*  ::  **::.   :: .*  **  :.:**::****:**:*.***

 

gi|62089534|M.M.                    RMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDR

gi|41327773|H.S.Prp5-DDX46          RMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDR

gi|24642151|D.M._Prp5_-             RMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNVRPDR

gi|14574201|C.E._Prp5_-F53H1.1      RMIDVLAANSGKVTNLRRVTYLVLDEADRMFDKGFEPQIMKVVNNIRPDK

gi|6319714|S.c.Prp5p                RFIDILTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKTVRPDK

                                    *:**:*: *.*:: . :*:*::*:*****:** *****: :::..:***:

 

gi|62089534|M.M.                    QTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVIE-EE

gi|41327773|H.S.Prp5-DDX46          QTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVIE-EE

gi|24642151|D.M._Prp5_-             QTVMFSATFPRQMEALARRILKKPIEVIVGGRSVVCKEVEQHVVILN-DD

gi|14574201|C.E._Prp5_-F53H1.1      QTVLFSATFPRHMEALARKVLDKPVEILVGGKSVVCSDITQNAVICA-EH

gi|6319714|S.c.Prp5p                QCVLFSATFPNKLRSFAVRVLHSPISITINSKGMVNENVKQKFRICHSED

                                    * *:******. :.::* ::* .*:.: :..:.:* .:: *:  :   :.

 

gi|62089534|M.M.                    KKFLKLLELLG-------------------HYQESGSVIIFVDKQEHADG

gi|41327773|H.S.Prp5-DDX46          KKFLKLLELLG-------------------HYQESGSVIIFVDKQEHADG

gi|24642151|D.M._Prp5_-             AKFFKLLELLG-------------------IYQEAGSIIVFVDKQENADI

gi|14574201|C.E._Prp5_-F53H1.1      QKFLKLLELLG-------------------MYYEEGSSIVFVDKQEKADD

gi|6319714|S.c.Prp5p                EKFDNLVQLIHERSEFFDEVQSENDGQSSDVEEVDAKAIIFVSSQNICDF

                                     ** :*::*:                         .. *:**..*: .*

 

gi|62089534|M.M.                    LLKDLMRASYPCMS-LHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGL

gi|41327773|H.S.Prp5-DDX46          LLKDLMRASYPCMS-LHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGL

gi|24642151|D.M._Prp5_-             LLRDLMKASYPCMS-LHGGIDQFDRDSTIIDFKSGKVRLLIATSVAARGL

gi|14574201|C.E._Prp5_-F53H1.1      IVDQLMRTGYNSVAPLHGGIDQHDRDSSIADFKTGVIKVLVATSVAARGL

gi|6319714|S.c.Prp5p                ISKKLLNAGIVTCA-IHAGKPYQERLMNLEKFKREKNSILLCTEVLSRGL

                                    :  .*:.:.    : :*.*    :*   : .**     :*:.*.* :***

 

gi|62089534|M.M.                    DVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITED-QARYAG

gi|41327773|H.S.Prp5-DDX46          DVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITED-QARYAG

gi|24642151|D.M._Prp5_-             DVKDLILVVNYDVPNHYEDYVHRCGRTGRAGKKGSAYTFITPE-QSRYAG

gi|14574201|C.E._Prp5_-F53H1.1      DVKNLILVVNYDCPNHYEDYVHRVGRTGRAGRKGYAYTFVLPEHQEKMAG

gi|6319714|S.c.Prp5p                NVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLLLHD---ELSG

                                    :* .: **: *.  : : :***  ***.*....* * *::  :   . :*

 

gi|62089534|M.M.                    DIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSS-GFSGKGFKFD

gi|41327773|H.S.Prp5-DDX46          DIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSS-GFSGKGFKFD

gi|24642151|D.M._Prp5_-             DIIRAMDLSGTLIPAELQALWTEYKALQEAEGKTVHTGG-GFSGKGFKFD

gi|14574201|C.E._Prp5_-F53H1.1      EICRAFETAGCKPPADLKAMFERFKSEMAAEGKEVKLGGKGFEGSGYKYD

gi|6319714|S.c.Prp5p                AYILSKAMRDEEIKALDPLQAKELQEMSAKFESGMKKGK--FRLSKGFGG

                                        :    .    .         :       . :: .   *  .    .

 

gi|62089534|M.M.                    ETEQALANERKKLQKAALGLQDSDDE-DAAVDIDEQIESMFNSKKRVKDM

gi|41327773|H.S.Prp5-DDX46          ETEQALANERKKLQKAALGLQDSDDE-DAAVDIDEQIESMFNSKKRVKDM

gi|24642151|D.M._Prp5_-             EQEFNAAKESKKLQKAALGLADSDDEEDIEQDIDQQIEQIFAAKRTVKDT

gi|14574201|C.E._Prp5_-F53H1.1      EGEAEADANKKRMTRLVHGMEAGGDD---DDDLEEQLSSMIKTKRRVVHG

gi|6319714|S.c.Prp5p                KGLENIKSKREEAQNKDLELKKNDKR---SDDLEKKISNPREGHDSVSE-

                                    :       : :.  .    :  ...      *:::::..    :  * .

 

 

 

 

gi|62089534|M.M.                    AAPGTSSVPAPTAG------------------------------------

gi|41327773|H.S.Prp5-DDX46          AAPGTSSVPAPTAG------------------------------------

gi|24642151|D.M._Prp5_-             SAAATAAAAAAAAAAAAAAAVSGANPALASAAAQAAAAAAAANIAIAAAS

gi|14574201|C.E._Prp5_-F53H1.1      KPQSEKPSSSSGNAKNDREAG-----------------------------

gi|6319714|S.c.Prp5p                --------------------------------------------------

                                                                                      

 

gi|62089534|M.M.                    -----------------NAEKLEIAKRLALRINAQKNLGIESQVDVMQQA

gi|41327773|H.S.Prp5-DDX46          -----------------NAEKLEIAKRLALRINAQKNLGIESQ-DVMQQA

gi|24642151|D.M._Prp5_-             APAAAGGAPSVAMGGALSSDKLELAKRLASKINSSKNLDTKGSVVTVEPM

gi|14574201|C.E._Prp5_-F53H1.1      ---------------KRADQAKLKAEELSTRLKGASQVVQPVEKTAAQLT

gi|6319714|S.c.Prp5p                --------------------------------------------------

                                                                                      

 

gi|62089534|M.M.                    TNAILRGGTILAPTVSAKTIAEQLAEKINAKLNYVPLEKQEEE-RQEGGQ

gi|41327773|H.S.Prp5-DDX46          TNAILRGGTILAPTVSAKTIAEQLAEKINAKLNYVPLEKQEEE-RQDGGQ

gi|24642151|D.M._Prp5_-             IKGPHVTG-AAATLLTARTVAEQMAAKLNNKLNYQPKEDEEGLGPLVGGT

gi|14574201|C.E._Prp5_-F53H1.1      AEAVLRGAEVAPAQMSAAMLAKEKANRLNEKLNYLGGEAAPTQ-----QQ

gi|6319714|S.c.Prp5p                ------------------------SSALIPRLNYELFKESTDG-------

                                                            :  :  :***   :           

 

gi|62089534|M.M.                    SESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP

gi|41327773|H.S.Prp5-DDX46          NESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP

gi|24642151|D.M._Prp5_-             TNPFTKYEEELEINDFPQQARWKVTSKEALAQISEYSEAGLTVRGTYVPQ

gi|14574201|C.E._Prp5_-F53H1.1      EEAWEYFEEEWDINDFPQQVRYKICSRESVGHVAELAEVGISVRGVHVPP

gi|6319714|S.c.Prp5p                ---SIIFYAKVYINDLPQIVRWEATKNTTLLFIKHETGCSITNKGKFYPE

                                          :  :  ***:** .*::  .. ::  : . :  .:: :* . *

 

gi|62089534|M.M.                    GKEPKE--GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQP-

gi|41327773|H.S.Prp5-DDX46          GKEPKE--GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQP-

gi|24642151|D.M._Prp5_-             GKNPPD--GERKLYLAIESCSELAVQKAKREITRLIKEELLKLSSAHHV-

gi|14574201|C.E._Prp5_-F53H1.1      GKEPKN--GERRLHLLLEARSERNLKAAKEEIIRIMKEAFRQLTAQLQRG

gi|6319714|S.c.Prp5p                GKEPKNENDEPKLYLLIEGQDEKDIQLSIELLEQKVKEGVVKAASLSLKS

                                    **:* :  .* :::* :*. .*  :: :   : : :** . :       

 

gi|62089534|M.M.                    TNKG-----

gi|41327773|H.S.Prp5-DDX46          TNKGRYKVL

gi|24642151|D.M._Prp5_-             FNKGRYKVV

gi|14574201|C.E._Prp5_-F53H1.1      GTQARYKV-

gi|6319714|S.c.Prp5p                TKY------

                                     .