S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Prp28p
YDR243C
F01F1.7 CG10333
RH55640p
DDX23 DDX23
Database Links
Cellular Function pre-mRNA splicing pre-mRNA splicing

Group Alignment

gi|24584994|D.M.CG10333-PA      --------------------------------------------------

gi|16768302|D.m._GM01081p       --------------------------------------------------

gi|51829897|M.M._DDX23          MLYSVSAGADGRVRRFRRGVVSLGGGGGSHEFGEWVRSGKIAVASARKGK

gi|12803125|H.S._DDX23          --------------------------------------------------

gi|14550364|C.e._prp28          --------------------------------------------------

gi|6320449|S.c.-Prp28p          --------------------------------------------------

                                                                                 

 

gi|24584994|D.M.CG10333-PA      --------------------------------------------------

gi|16768302|D.m._GM01081p       --------------------------------------------------

gi|51829897|M.M._DDX23          NASGKGHEPGQLRRARVKGARAPGAVLAAQGTGHFQDCIMSLDFGPWTSP

gi|12803125|H.S._DDX23          --------------------------------------------------

gi|14550364|C.e._prp28          --------------------------------------------------

gi|6320449|S.c.-Prp28p          --------------------------------------------------

                                                                                 

 

gi|24584994|D.M.CG10333-PA      -------MVNDKKRRSRSRERHREDRPAVGNPRDRERERDRVRERDRQFD

gi|16768302|D.m._GM01081p       --------------------------------------------------

gi|51829897|M.M._DDX23          LLYMAGELADKKDRDASP-KEERKRSRTPERDRDRDRDRKSSPSKDRKRH

gi|12803125|H.S._DDX23          ---MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRH

gi|14550364|C.e._prp28          -------MAAEPPSLEELLEKKKREEDELAKPKFLSKAERAALALKRREE

gi|6320449|S.c.-Prp28p          --------------------------------------------------

                                                                                 

 

gi|24584994|D.M.CG10333-PA      REKERRQ----RRSRSREDRNRRRSPERQRPRDNVRERSR-ERGGGAGGG

gi|16768302|D.m._GM01081p       --------------------------------------------------

gi|51829897|M.M._DDX23          RSRDRRRGGSRSRSRSRSKSVERERRHKERERDKERDRSKKERERDKDGH

gi|12803125|H.S._DDX23          RSRDRRRGGSRSRSRSRSKSAERERRHKERERDKERDRNKKDRDRDKDGH

gi|14550364|C.e._prp28          -----------EVAKLRETQKQAEEARKNWGRTEKTSDDRRDRGLDR-GN

gi|6320449|S.c.-Prp28p          ------------MARPIDVSQLIAGINKKKGLDEN---------------

                                                                                  

 

gi|24584994|D.M.CG10333-PA      GGGGAEKKAKMDTGD----APPKPLIVDDEEQQDGKEAKVKKEPLSLEEL

gi|16768302|D.m._GM01081p       --------------------------------------------------

gi|51829897|M.M._DDX23          RRDKDRKRSSLSPGRGKDFKSRKDRDSKKGDEDEHGDKRPKIQPLSLEEL

gi|12803125|H.S._DDX23          RRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEEL

gi|14550364|C.e._prp28          DRDRDRER------------------------------------------

gi|6320449|S.c.-Prp28p          --------------------------------------------------

                                                                                 

 

gi|24584994|D.M.CG10333-PA      LDKKKREEEARSKPVFLTKEQRALEAIKRRQEEVERQRAAHDAAREQMAA

gi|16768302|D.m._GM01081p       -----------------------------------------------MAA

gi|51829897|M.M._DDX23          LAKKKAEEEAEAKPKFLSKAEREAEALKRRQQEVE--------ERQKMLE

gi|12803125|H.S._DDX23          LAKKKAEEEAEAKPKFLSKAEREAEALKRRQQEVE--------ERQRMLE

gi|14550364|C.e._prp28          --------------------ERDRDRRRDRR------------ERSGSRD

gi|6320449|S.c.-Prp28p          -------------------------------------------------T

                                                                                 

 

gi|24584994|D.M.CG10333-PA      ASKVSISMGTAMASGAPPPAIVAPPPKPDRRERGGGRDRGDRIDRGERGD

gi|16768302|D.m._GM01081p       ASKVSISMGTAMASGAPPPAIVAPPPKPDRRERGGGRDRGDRIDRGERGD

gi|51829897|M.M._DDX23          EERKKRKQFQDLGR-----KMLEDPQERERRER---RERMERETNGNEDE

gi|12803125|H.S._DDX23          EERKKRKQFQDLGR-----KMLEDPQERERRER---RERMERETNGNEDE

gi|14550364|C.e._prp28          RRRRSRSRDRDGGR---------------RRDRSRSRDRRDRND--DRKR

gi|6320449|S.c.-Prp28p          SGKISKPRFLNKQE----------------------RSKQERLKENEESL

                                  : .                               *.: :*    :. 

 

gi|24584994|D.M.CG10333-PA      DKRAEDLTHKDKEKELEAIRERYLGIIK-KKRRVRRLNDRKFVFDWDAGE

gi|16768302|D.m._GM01081p       DKRAEDLTHKDKEKELEAIRERYLGIIK-KKRRVRRLNDRKFVFDWDAGE

gi|51829897|M.M._DDX23          EGRQKIREEKDKSKELHAIKERYLGGIK-KRRRTRHLNDRKFVFEWDASE

gi|12803125|H.S._DDX23          EGRQKIREEKDKSKELHAIKERYLGGIK-KRRRTRHLNDRKFVFEWDASE

gi|14550364|C.e._prp28          DRNEDSDNEEDVSKMADAVKDRYLGKQKEKKKRGRRLHEKKFVFDWDAGE

gi|6320449|S.c.-Prp28p          TPTQ-SDSAKVEIKKVNSRDDSFFNETNDKKRNPSKQNGSKFHFSWNESE

                                         :   *  .:  : ::.  : *::.  : :  ** *.*: .*

 

gi|24584994|D.M.CG10333-PA      DTSIDYNNLYKERHHVQFFGRGNVAGIDIKEQKRTQSKFYGDLLEKRRTE

gi|16768302|D.m._GM01081p       DTSIDYNNLYKERHHVQFFGRGNVAGIDIKEQKRTQSKFYGDLLEKRRTE

gi|51829897|M.M._DDX23          DTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTL

gi|12803125|H.S._DDX23          DTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLMEKRRTL

gi|14550364|C.e._prp28          DTSQDYNKLYQSRHEIQFFGRGSVAGTDVNAQKKEKNSFYQEMMENRRTV

gi|6320449|S.c.-Prp28p          DTLSGYDPIVSTR-AIDLLWKG----------------------------

                                **  .*: : . *  :::: :*                           

 

gi|24584994|D.M.CG10333-PA      AEKEQEKVRLKKMKRKEDKQKWDDRHWSEKENDEMTERDWRIFREDYNVT

gi|16768302|D.m._GM01081p       AEKEQEKVRLKKMKRKEDKQKWDDRHWSEKENDEMTERDWRIFREDYNVT

gi|51829897|M.M._DDX23          EEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSIT

gi|12803125|H.S._DDX23          EEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSIT

gi|14550364|C.e._prp28          DEKEQEMHRLEKELKKEKKVAHDDRHWRMKELSEMSDRDWRIFREDFNIS

gi|6320449|S.c.-Prp28p          -----------KTPKNAAESSYMGKHWTEKSLHEMNERDWRILKEDYAIV

                                           *  ::  :    .:**  *.  **.:*****::**: :

 

gi|24584994|D.M.CG10333-PA      IKGGRIPNPIRSWNESGFP--KEIIDIIDKVGYKEPTPIQRQAIP---IG

gi|16768302|D.m._GM01081p       IKGGRIPNPIRSWNESGFP--KEIIDIIDKVGYKEPTPIQRQAIP---IG

gi|51829897|M.M._DDX23          TKGGKIPNPIRSWKDSSLP--PHILEVIDKCGYKEPTPIQRQAIP---IG

gi|12803125|H.S._DDX23          TKGGKIPNPIRSWKDSSLP--PHILEVIDKCGYKEPTPIQRQAIP---IG

gi|14550364|C.e._prp28          IKGGRVPRPLRNWEEAGFP--DEVYQAVKEIGYLEPTPIQRQAIP---IG

gi|6320449|S.c.-Prp28p          TKGGTVENPLRNWEELNIIPRDLLRVIIQELRFPSPTPIQRITIPNVCNM

                                 *** : .*:*.*:: .:     :   :.:  : .****** :**    

 

gi|24584994|D.M.CG10333-PA      LQNRDIIGVAETGSGKTLAFLIPLLSWIQSLP---KIE------------

gi|16768302|D.m._GM01081p       LQNRDIIGVAETGSGKTLAFLIPLLSWIQSLP---KIE------------

gi|51829897|M.M._DDX23          LQNRDIIGVAETGSGKTAAFLIPLLVWITTLP---KIDSCSKSNFVLFLL

gi|12803125|H.S._DDX23          LQNRDIIGVAETGSGKTAAFLIPLLVWITTLP---KID------------

gi|14550364|C.e._prp28          LQNRDVIGVAETGSGKTAAFLLPLLVWITSLP---KME------------

gi|6320449|S.c.-Prp28p          KQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRP---------------

                                 * **.:***.****** **::*:*  :   *                 

 

gi|24584994|D.M.CG10333-PA      -----------------RLEDVDQGPYAIIMAPTRELAQQIEEETTKFGQ

gi|16768302|D.m._GM01081p       -----------------RLEDVDQGPYAIIMAPTRELAQQIEEETTKFGQ

gi|51829897|M.M._DDX23          VVNETKAYGDVGYPIYHRIEESDQGPYAIILAPTRELAQQIEEETIKFGK

gi|12803125|H.S._DDX23          -----------------RIEESDQGPYAIILAPTRELAQQIEEETIKFGK

gi|14550364|C.e._prp28          -----------------RQEHRDLGPYAIIMAPTRELAQQIEEETNKFGK

gi|6320449|S.c.-Prp28p          -----------------PSLKIIDGPKALILAPTRELVQQIQKETQKVTK

                                                    .   ** *:*:******.***::** *. :

 

gi|24584994|D.M.CG10333-PA      PLG------IRTVVVVGGLSREEQGFRLRLGCEIVIATPGRLIDVLENRY

gi|16768302|D.m._GM01081p       PLG------IRTVVVVGGLSREEQGFRLRLGCEIVIATPGRLIDVLENRY

gi|51829897|M.M._DDX23          PLG------IRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRY

gi|12803125|H.S._DDX23          PLG------IRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRY

gi|14550364|C.e._prp28          LLG------IKTVSVIGGASREDQGMKLRMGVEVVIATPGRLLDVLENRY

gi|6320449|S.c.-Prp28p          IWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGRLIDSLENHL

                                  .       :.: ::** * *: .: *  * ::::******:* ***:

 

gi|24584994|D.M.CG10333-PA      LVLNQCTYIVLDEADRMIDMGFEPDVQKILEYMPVTNLKPDTEEAEDETK

gi|16768302|D.m._GM01081p       LVLNQCTYIVLDEADRMIDMGFEPDVQKILEYMPVTNLKPDTEEAEDETK

gi|51829897|M.M._DDX23          LVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEK

gi|12803125|H.S._DDX23          LVLSRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEK

gi|14550364|C.e._prp28          LLLNQCTYVILDEADRMLDMGFEPDVQKVLEYMPDTNMKKDTDEFDNEEA

gi|6320449|S.c.-Prp28p          LVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDIN-----ADSAVN---

                                *::.:   ::*****:*:*:*** :* ::*  :  .     ::.  :  

 

gi|24584994|D.M.CG10333-PA      LMENFYT-KKKYRQTVMFTATMPPAVERLARTYLRRPATVYIGSVGKPTE

gi|16768302|D.m._GM01081p       LMENFYT-KKKYRQTVMFTATMPPAVERLARTYLRRPATVYIGSVGKPTE

gi|51829897|M.M._DDX23          MLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHE

gi|12803125|H.S._DDX23          MLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHE

gi|14550364|C.e._prp28          LMKGFST-REKYRQTVMFTATMSSAIERLARQYLRRPAVVHIGSAGKPTE

gi|6320449|S.c.-Prp28p          ------------RQTLMFTATMTPVIEKIAAGYMQKPVYATIGVETGSEP

                                            ***:******...:*::*  *:::*. . **    . 

 

gi|24584994|D.M.CG10333-PA      RTEQIVYMMGENDKRKKLMEILSRKIDPPVIIFVNQKKGADVLAKGLEKL

gi|16768302|D.m._GM01081p       RTEQIVYMMGENDKRKKLMEILSRKIDPPVIIFVNQKKGADVLAKGLEKL

gi|51829897|M.M._DDX23          RVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKM

gi|12803125|H.S._DDX23          RVEQKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKM

gi|14550364|C.e._prp28          RVEQVVYMVPEDRKRKKLVEVLESQFQPPIIIFVNQKKGADMLSKGLTKL

gi|6320449|S.c.-Prp28p          LIQQVVEYADNDEDKFKKLKPIVAKYDPPIIIFINYKQTADWLAEKFQKE

                                  :* *    :. .: * :  :    :**:***:* *: .* *:: : *

 

gi|24584994|D.M.CG10333-PA      G-YNSCTLHGGKGQEQREYALAALKSGAKDILVATDVAGRGIDIKDVSLV

gi|16768302|D.m._GM01081p       G-YNSCTLHGGKGQEQREYALAALKSGAKDILVATDVAGRGIDIKDVSLV

gi|51829897|M.M._DDX23          G-YNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMV

gi|12803125|H.S._DDX23          G-YNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIQDVSMV

gi|14550364|C.e._prp28          G-FKPTVLHGGKGQDQREYALQALKEGTSDILVATDVAGRGIDVKDVSLV

gi|6320449|S.c.-Prp28p          TNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARGLDIPNVSLV

                                   :   ***.*.*:***.:*  :: .  :*::**:**.**:*: :**:*

 

gi|24584994|D.M.CG10333-PA      INYDMAKTIEDYTHRIGRTGRAGKTGCAISFVTKDDSALFYDLKQCVSAS

gi|16768302|D.m._GM01081p       INYDMAKTIEDYTHRIGRTGRAGKTGCAISFVTKDDSALFYDLKQCVSAS

gi|51829897|M.M._DDX23          VNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILES

gi|12803125|H.S._DDX23          VNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILES

gi|14550364|C.e._prp28          LNYDMAKSIEDYTHRIGRTGRAGKHGKAITFLTPDDTAVYFDLKQVLVES

gi|6320449|S.c.-Prp28p          VNFQISKKMDDYIHRIGRTGRAANEGTAVSFVSAAE----DESLIRELYK

                                :*::::*.::** *********.: * *::*::  :     :       .

 

gi|24584994|D.M.CG10333-PA      PVSTCPPELMNHPEAQHKPGTVVTKKRREEKIFA-

gi|16768302|D.m._GM01081p       PVSTCPPELMNHPEAQHKPGTVVTKKRREEKIFA-

gi|51829897|M.M._DDX23          PVSSCPPELANHPDAQHKPGTILTKKRREETIFA-

gi|12803125|H.S._DDX23          PVSSCPPELANHPDAQHKPGTILTKKRREETIFA-

gi|14550364|C.e._prp28          PVSSCPPELANHPDAQSKPGVFTSKKRQDETLFLK

gi|6320449|S.c.-Prp28p          YVRKHDPLNSNIFSEAVKNKYNVGKQLSNEIIY--

                                 * .  *   *  .   *      *:  :* ::