S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Dbp2p
YNL112W
Rm62_DROME
Dmp68, p62
CG10279
DDX5 / p68 DDX5 / p68
Database Links
Protein DDX17 DDX17 / p72
Database Links
Cellular Function
  • Transcription
  • RNA decay

Group Alignment

sp|P24783|DBP2_YEAST      ------------------------------------------------------------
Q92841|DDX17_HUMAN        ------------------------------------------------------------
Q501J6|DDX17_MOUSE        ------------------------------------------------------------
sp|P17844|DDX5_HUMAN      ------------------------------------------------------------
sp|Q61656|DDX5_MOUSE      ------------------------------------------------------------
P19109|RM62_DROME         MLKLVQYIAPRVGGATPRPTACGWGNLLLISPRSGASSEKCITQRRHFLFSSASSSGTFA
                                                                                      
 
sp|P24783|DBP2_YEAST      ------------------------------------------------------------
Q92841|DDX17_HUMAN        ------------------------------------------------------------
Q501J6|DDX17_MOUSE        ------------------------------------------------------------
sp|P17844|DDX5_HUMAN      ------------------------------------------------------------
sp|Q61656|DDX5_MOUSE      ------------------------------------------------------------
P19109|RM62_DROME         SSSSLCTEQRQQFHGSRRNRETILFPSTYSSLQAQSQRAFRDSSKPDSDDYVDSIPKAEQ
                                                                                      
 
sp|P24783|DBP2_YEAST      ----------------------------------------------MTYGGRDQQYNKTN
Q92841|DDX17_HUMAN        ------------------------------------------------------------
Q501J6|DDX17_MOUSE        ------------------------------------------------------------
sp|P17844|DDX5_HUMAN      ------------------------------------------------------------
sp|Q61656|DDX5_MOUSE      ------------------------------------------------------------
P19109|RM62_DROME         RTRTRKSLFNDPDERTEEIKIEGVMAPHDRDFGHSGRGGRGGDRGGDDRRGGGGGGNRFG
                                                                                      
 
sp|P24783|DBP2_YEAST      YKSRGGDFRGGRNSDRNSYNDRPQGGNYRGG---FGGRSNYNQPQELIKPNWDEELPKLP
Q92841|DDX17_HUMAN        -------MRGGGFGDRDRDRDRGG----FGARGGGGLPPKKFGNPGERLRKKKWDLSELP
Q501J6|DDX17_MOUSE        -------MRGGGFGDRDRDRDRGG----FGARGGSGLPPKKFGNPGERLRKKKWDLSELP
sp|P17844|DDX5_HUMAN      --------MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELP
sp|Q61656|DDX5_MOUSE      --------MSSYSSDRDRGRDRGFGAPRFGGSRTGPLSGKKFGNPGEKLVKKKWNLDELP
P19109|RM62_DROME         GGGGGGDYHGIRNGRVEKRRDDRGGGNRFGGGGGFGDRRGGGGGGSQDLPMRPVDFSNLA
                                   .   .  :  .*        *.                       :: :*.
 
sp|P24783|DBP2_YEAST      TFEKNFYVEHESVRDRSDSEIAQFRKENEMTISG-HDIPKPITTFDEAGFPDYVLNEVKA
Q92841|DDX17_HUMAN        KFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMD
Q501J6|DDX17_MOUSE        KFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMD
sp|P17844|DDX5_HUMAN      KFEKNFYQEHPDLARRTAQEVETYRRSKEITVRG-HNCPKPVLNFYEANFPANVMDVIAR
sp|Q61656|DDX5_MOUSE      KFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRG-HNCPKPVLNFYEANFPANVMDVIAR
P19109|RM62_DROME         PFKKNFYQEHPNVANRSPYEVQRYREEQEITVRG--QVPNPIQDFSEVHLPDYVMKEIRR
                           *:**** ** .:   :  *:   *..:*:*: *    *:*:  * .. :*  *:. :  
 
sp|P24783|DBP2_YEAST      EGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAPGDGPIVL
Q92841|DDX17_HUMAN        QHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICL
Q501J6|DDX17_MOUSE        QHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICL
sp|P17844|DDX5_HUMAN      QNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICL
sp|Q61656|DDX5_MOUSE      HNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHHPFLERGDGPICL
P19109|RM62_DROME         QGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIAL
                          . :  ** **.**:*:*:** ::**:* *******.* **.***** :  *  ***** *
 
sp|P24783|DBP2_YEAST      VLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDM
Q92841|DDX17_HUMAN        VLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDF
Q501J6|DDX17_MOUSE        VLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDF
sp|P17844|DDX5_HUMAN      VLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDF
sp|Q61656|DDX5_MOUSE      VLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDF
P19109|RM62_DROME         VLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDF
                          ********* *:*  . .:  .. ::.**::**.**. *:***.** ** *********:
 
sp|P24783|DBP2_YEAST      LEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVKQLAA
Q92841|DDX17_HUMAN        LESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAE
Q501J6|DDX17_MOUSE        LESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAE
sp|P17844|DDX5_HUMAN      LECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAE
sp|Q61656|DDX5_MOUSE      LECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAE
P19109|RM62_DROME         LSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAE
                          *. *.***:* ************************.*******************:*** 
 

sp|P24783|DBP2_YEAST      DYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLETASQDNE--YKTLIFAS
Q92841|DDX17_HUMAN        DFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKE--NKTIIFVE
Q501J6|DDX17_MOUSE        DFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKE--NKTIIFVE
sp|P17844|DDX5_HUMAN      DFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKE--NKTIVFVE
sp|Q61656|DDX5_MOUSE      DFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKE--NKTIVFVE
P19109|RM62_DROME         DFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVE
                          *:* :  ::::* *****.*** *:*:*  : .* .:*   :.     .*   * ::*..
 
sp|P24783|DBP2_YEAST      TKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKG
Q92841|DDX17_HUMAN        TKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVED
Q501J6|DDX17_MOUSE        TKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVED
sp|P17844|DDX5_HUMAN      TKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVED
sp|Q61656|DDX5_MOUSE      TKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVED
P19109|RM62_DROME         TKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDG
                          ***  *::.: :*  *  .  *****.* ***:**.**: *:: *::*****:**:**..
 
sp|P24783|DBP2_YEAST      INYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEQNKGLGAKLISIMREANQNIPP
Q92841|DDX17_HUMAN        VKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINP
Q501J6|DDX17_MOUSE        VKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINP
sp|P17844|DDX5_HUMAN      VKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINP
sp|Q61656|DDX5_MOUSE      VKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINP
P19109|RM62_DROME         IKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQAKALVDVLREANQEINP
                          :::***:* * . ***:******.*:  .**: :***  *      *:.::.**** * *
 
sp|P24783|DBP2_YEAST      ELLKYDRRS-YGGGHP----------------------RYGGGRGGRGGYGRRGGYGGGR
Q92841|DDX17_HUMAN        KLMQLVDHRGGGGGGGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRS
Q501J6|DDX17_MOUSE        KLMQLVDHRGGGGGGGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSTSYRDRS
sp|P17844|DDX5_HUMAN      KLLQLVEDRGSGRSRGRGG--------------MKDDRRDRYSAGKRGGFNTFRDRENYD
sp|Q61656|DDX5_MOUSE      KLLQLVEDRGSGRSRGRGG--------------MKDDRRDRYSAGKRGGFNTFRDRENYD
P19109|RM62_DROME         ALENLARNSRYDGGGG----------------------RSRYGGGGGGGRFGGGGFKKGS
                           * :       . .                                 **     .     
 
sp|P24783|DBP2_YEAST      GGYGGNRQRDGGWGNRGRSNY---------------------------------------
Q92841|DDX17_HUMAN        ETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTT
Q501J6|DDX17_MOUSE        ETDRASYANGSGYGSPNSAFGAQAGQYTYAQGTYGAAAYGTSGYTAQEYAAGTYGASSTA
sp|P17844|DDX5_HUMAN      RGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQ
sp|Q61656|DDX5_MOUSE      RGYSNLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQ
P19109|RM62_DROME         LSNGRGFGGGGGGGGEGRHSRFD-------------------------------------
                                   . *    .                                           
 
sp|P24783|DBP2_YEAST      ------------------------------------------------------------
Q92841|DDX17_HUMAN        STGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPP
Q501J6|DDX17_MOUSE        SAGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPP
sp|P17844|DDX5_HUMAN      QYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ---------------------
sp|Q61656|DDX5_MOUSE      QYGSNVANMHNGMNQQAYAYPVPQPAPMIGYPMPTGYSQ---------------------
P19109|RM62_DROME         ------------------------------------------------------------
                                                                                      
 
sp|P24783|DBP2_YEAST      ---
Q92841|DDX17_HUMAN        SRK
Q501J6|DDX17_MOUSE        SRK
sp|P17844|DDX5_HUMAN      ---
sp|Q61656|DDX5_MOUSE      ---
P19109|RM62_DROME         ---