S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Mak5p
YBR142W
F55F8.2 CG9143p DDX24 DDX24
Database Links
Cellular Function Ribosome Biogenesis

Group Alignment

gi|18202876|M.M._DDX24      --------------------------------------------------

gi|18202929|H.S.DDX24       -MKLKDTKSRPKQSSCGKFQTKGIKVVGKWKEVKIDPNMFADGQMDDLVC

gi|7504318|C.E._Mak5        --------------------MTNISIPGNWQTCDVEA-------------

gi|33636633|D.M.Mak5        MVQNKQKTAKPPKLLKGAAKEPALSKAENWQKVKIKGHVISDDGGGFEGL

gi|536442|S.C._MAK5         --MGKKRAPQKGKTVTKPQEIIVDESKLNWKPVDIPDTLD----------

                                                                              

 

gi|18202876|M.M._DDX24      ----------------------------------TKKRKAQAVSEEEEEE

gi|18202929|H.S.DDX24       FEELTDYQLVSPAKNPSS-----------LFSKEAPKRKAQAVSEEEEEE

gi|7504318|C.E._Mak5        --------MDGDFDDNML-----------QFLGSFEEVLPEGVEVETKKG

gi|33636633|D.M.Mak5        IGLEVLKDYDASLVKSSQKRTTSRNPDRERKLKKKKRKVSKGDEEESSES

gi|536442|S.C._MAK5         -----------------------------DFGGFYGLEEIDGVDVKVVDG

                                                                    .. . :  .

 

gi|18202876|M.M._DDX24      EGQSSSPKKKIKLKKQRDAARAAEGAAAQNEYEVKASEPEAQGEVTACSD

gi|18202929|H.S.DDX24       EGKSSSPKKKIKLKKSKNVA--TEGTSTQKEFEVKDPELEAQGDDMVCDD

gi|7504318|C.E._Mak5        MKKKNKPKKVENTERPEEDAKCVEERRLAKKLRRKE-QMAANRKQKKERL

gi|33636633|D.M.Mak5        SSESESEDEVAVAARTSKKARLAERHAQKMQKLREKREKRKELRKQKKSK

gi|536442|S.C._MAK5         KVTFVTKKDSKVLKDSNKEKVGDDQESVENESGSDSESELLEFKNLDDIK

                                 . ..        .     :      :   .  .   :       

 

gi|18202876|M.M._DDX24      QKVGGAKSESLAQAAPR--------KKKNKGKKKLDTFQSTSPKLPKKSK

gi|18202929|H.S.DDX24       PEAGEMTSENLVQTAPK--------KKKNKGKKGLEPSQSTAAKVPKKAK

gi|7504318|C.E._Mak5        AKRKQKEAESSAKKSEN--------ATETTTEKPKEQKKRKGGENGDTGK

gi|33636633|D.M.Mak5        GKENDNSEESSDEHAADRFALLRPPPSDDEEEVVKAEDSADQQESTDEEA

gi|536442|S.C._MAK5         EGELSAASYSSSDEDEQG----NIESSKLTDPSEDVDEDVDEDVLKENVF

                                     .  .             ..          .       .  

 

gi|18202876|M.M._DDX24      KTWMAEVHDQKADVSAWRDL-FVPKAVLRALSFLGFSAPTPIQALTLAPA

gi|18202929|H.S.DDX24       -TWIPEVHDQKADVSAWKDL-FVPRPVLRALSFLGFSAPTPIQALTLAPA

gi|7504318|C.E._Mak5        PKKSKKEASKKTDISAWKQFYFLPNEVLEAIEQMGFSEPTEIQSAVLPAA

gi|33636633|D.M.Mak5        PELVPISTGEAEDMSAWNGL-GVPASILRALGEQGFKTPTQIQALTLPAA

gi|536442|S.C._MAK5         NKDINIDDISPVNLPEWTNLAPLSMTILQSLQNLNFLRPTEIQKKSIPVI

                                     .  ::. *  :  :.  :*.::   .*  ** **   :. 

 

gi|18202876|M.M._DDX24      IRDKLDILGAAETGSGKTLAFAIPMIHSVLQWHKMKAPP---IPRSTGMP

gi|18202929|H.S.DDX24       IRDKLDILGAAETGSGKTLAFAIPMIHAVLQWQKRNAAP---PPSNTEAP

gi|7504318|C.E._Mak5        VRDRQDVLGAAETGSGKTLAFGIPLVARLLESSDDSQET---ESTEVRGP

gi|33636633|D.M.Mak5        IHGKKDILGAAETGSGKTLAFGIPMLAGIMELKQRNIRSGIRKAPKVKGQ

gi|536442|S.C._MAK5         MQG-VDVMGKASTGSGKTLAYGIPIVEKLISNFSQKNKK-----------

                            ::.  *::* *.********:.**::  ::.  . .             

 

gi|18202876|M.M._DDX24      PREMRFGATAHLGSPCKDRTESGVLPEEARIETEAQPSDSGVQATPETSA

gi|18202929|H.S.DDX24       PGETRTEAGAETRSPGKAEAESDALPDDTVIESEALPSDIAAEARAKTGG

gi|7504318|C.E._Mak5        R-------------------------------------------------

gi|33636633|D.M.Mak5        QPEPAADEHELTPPPEELDHVSGASDEESDAEEQAQR-------------

gi|536442|S.C._MAK5         --------------------------------------------------

                                                                              

 

gi|18202876|M.M._DDX24      SASAQTLLVCDDDAGEGPSSLE-EKPVPKQNEDGEEKFDAEQAGKLKQEL

gi|18202929|H.S.DDX24       TVSDQALLFGDDDAGEGPSSLIREKPVPKQNENEEENLDKEQTGNLKQEL

gi|7504318|C.E._Mak5        --------------------------------------------------

gi|33636633|D.M.Mak5        --------------------------------------------------

gi|536442|S.C._MAK5         --------------------------------------------------

                                                                              

 

gi|18202876|M.M._DDX24      CDQIAIYKVHPRRPLLGLVLTPTRELAIQVRQHIDAVAK----FTGINTA

gi|18202929|H.S.DDX24       DDKSATCKAYPKRPLLGLVLTPTRELAVQVKQHIDAVAR----FTGIKTA

gi|7504318|C.E._Mak5        ----------------ALIVAPTRELVIQIMKHINALIS----TTQLIAT

gi|33636633|D.M.Mak5        ----------VQTPLYGLVLTPTRELAVQVKNHLVAAAK----YTGIRVA

gi|536442|S.C._MAK5         --------------PISLIFTPTRELAHQVTDHLKKICEPVLAKSQYSIL

                                            .*:.:*****. *: .*:          :    

 

gi|18202876|M.M._DDX24      ILVGGMSTQKQQRMLNR--HPEIVIATPGRLWELVKEKHP--HLSNLRQL

gi|18202929|H.S.DDX24       ILVGGMSTQKQQRMLNR--RPEIVVATPGRLWELIKEKHY--HLRNLRQL

gi|7504318|C.E._Mak5        SIVGGLAQVKQERIISQQ-RPDIVVATPGRLWAMMQEAETGEFLAEWKDL

gi|33636633|D.M.Mak5        AIFGGLAVAKQERVLRQ--CPDIVVATPGRLWELYAQGNR--HLGKIEDV

gi|536442|S.C._MAK5         SLTGGLSIQKQQRLLKYDNSGQIVIATPGRFLELLEKDNT--LIKRFSKV

                             : **::  **:*::      :**:*****:  :  : .    : .  .:

 

gi|18202876|M.M._DDX24      RCLVIDEADRMVEKGHFAELSQLLEMLN-DSQYNPSR--------QTLVF

gi|18202929|H.S.DDX24       RCLVVDEADRMVEKGHFAELSQLLEMLN-DSQYNPKR--------QTLVF

gi|7504318|C.E._Mak5        KCLVVDETDRMVEEGYFAELTHILNKIH-EESEKEKL--------QTLVF

gi|33636633|D.M.Mak5        SFLVIDETDRMVEKGHFEELRSLLKVLNSDEQKKHQR--------QNFVY

gi|536442|S.C._MAK5         NTLILDEADRLLQDGHFDEFEKIIKHLLVERRKNRENSEGSSKIWQTLIF

                              *::**:**:::.*:* *:  ::: :  :   : .         *.:::

 

gi|18202876|M.M._DDX24      SATLTLVHQAPARILHKKHVK-----KMDKTDKLDLLMQKVGMR-GKPKV

gi|18202929|H.S.DDX24       SATLTLVHQAPARILHKKHTK-----KMDKTAKLDLLMQKIGMR-GKPKV

gi|7504318|C.E._Mak5        SATLTFAKAQDVAEEEKKKAK-----ELSSQQKIQRLIKLTGLRENKHKV

gi|33636633|D.M.Mak5        SATLTLVHDLPDHMQKRNVGKRPKFVKQTVDQKIESLIEELGIS--QPKI

gi|536442|S.C._MAK5         SATFSIDLFDKLSSSRQVKDRRFKNNEDELNAVIQHLMSKIHFN-SKPVI

                            ***:::         .:   :     :      :: *:.   :   :  :

 

gi|18202876|M.M._DDX24      IDLTRERGTVETLTETKIHC-ETDEKDLYLYYFLMQYPGRSLVFANSISC

gi|18202929|H.S.DDX24       IDLTRNEATVETLTETKIHC-ETDEKDFYLYYFLMQYPGRSLVFANSISC

gi|7504318|C.E._Mak5        IDLTRQMGTAGCLVEARINCGNLLEKDTSLVYLLTRYPGRTIVFVNSIDA

gi|33636633|D.M.Mak5        VDITSSQQTAQTLTESRLLC-PIDHKDYHLYYFIQRHPGRTIVFCNSIDC

gi|536442|S.C._MAK5         IDTNPESKVSSQIKESLIEC-PPLERDLYCYYFLTMFPGTTLIFCNAIDS

                            :* . .  .   : *: : *    .:*    *::  .** :::* *:*..

 

gi|18202876|M.M._DDX24      IKRLSGLLKVLDVMPLTLHACMHQKQRLRNLEQFARL-------------

gi|18202929|H.S.DDX24       IKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARL-------------

gi|7504318|C.E._Mak5        ARRLYSVLKSVNIDPMILHAKMIQKQRLKNLEKFSES-------------

gi|33636633|D.M.Mak5        VKRLATLFGLLDCNPLPLHANMIQKQRLKNLERFRDS-------------

gi|536442|S.C._MAK5         VKKLTVYLNNLGIPAFQIHSSMTQKNRLKSLERFKQQSAKQKTINHSNPD

                             ::*   :  :.  .: :*: * **:**:.**:*               

 

gi|18202876|M.M._DDX24      ---QDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYIHRSGRTARAAS

gi|18202929|H.S.DDX24       ---EDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATN

gi|7504318|C.E._Mak5        ---KNAVLLATDVAARGLDIQGIDHVIHYQVPKKVEIYIHRSGRTARASH

gi|33636633|D.M.Mak5        ---PTGLLIATDVAARGLDIPNVEHVIHYQVPRTSENYVHRSGRTARANK

gi|536442|S.C._MAK5         SVQLSTVLIASDVAARGLDIPGVQHVIHYHLPRSTDIYIHRSGRTARAGS

                                  :*:*:*********  ::*****::*:. : *:********* 

 

gi|18202876|M.M._DDX24      EGLSLMLIGPEDVI-NFKKIYKTLQKD--------------------EDI

gi|18202929|H.S.DDX24       EGLSLMLIGPEDVI-NFKKIYKTLKKD--------------------EDI

gi|7504318|C.E._Mak5        RGLTVVLVDPPSRQ-FYMKLCKGLNRM--------------------QDL

gi|33636633|D.M.Mak5        HGITVMFMEPGEVK-SYVKLYKTLERT--------------------EDL

gi|536442|S.C._MAK5         EGVSAMICSPQESMGPLRKLRKTLATKNSVSTDLNSRSTNRKPIKWQNTV

                            .*:: ::  * .      *: * *                       : :

 

gi|18202876|M.M._DDX24      PLFPVQSK-YMDVVKERIRLARQIEKAEYRNFQACLHNSWIEQAAAALEI

gi|18202929|H.S.DDX24       PLFPVQTK-YMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEI

gi|7504318|C.E._Mak5        NVFPIDFEPLMNAIKKRVRLASEIDSLGFRCKKIKMSESWFEKAARAADL

gi|33636633|D.M.Mak5        PLFPILER-FMGAVRERVNLARDLDKEELKLKRVQSERGWMKKHAEEMDM

gi|536442|S.C._MAK5         PLLPIETD-ILSQLRERSRLAGELADHEIASNSLRKDDNWLKKAADELGI

                             ::*:     :. :::* .** :: .            .*::: *    :

 

gi|18202876|M.M._DDX24      ELEEEMYKGGKADQQ-----------EERRRQKQMKMLKQELRHLLSQPL

gi|18202929|H.S.DDX24       ELEEDMYKGGKADQQ-----------EERRRQKQMKVLKKELRHLLSQPL

gi|7504318|C.E._Mak5        DYDETRHREMDGLNL-----------EVDTMVQKSRQLQAQLRTELSLPL

gi|33636633|D.M.Mak5        IIDGYNDESGSDQDEDPFV------IERRRNRLRVETVRAQLNALLAQPI

gi|536442|S.C._MAK5         DVDSDEDDISKSNSDTFLLKNKNKKMQKTINKDKVKAMRATLNELLSVPI

                              :       .  .            :      : . ::  *.  *: *:

 

gi|18202876|M.M._DDX24      FQENLKTRYPTQSGRPPQPVLASRNIESALSCLSRQKRRR-KKPKEPR-A

gi|18202929|H.S.DDX24       FTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKEPQPE

gi|7504318|C.E._Mak5        PRVDGSDSMKTKYITPEIVARLRSVGDNAIDVLNQKIDETKEWKRKSRKA

gi|33636633|D.M.Mak5        FPRGFSFKYPNSEAAQLATSHTQSAVETMKAAIEDQKQAKKDRNKRKRNA

gi|536442|S.C._MAK5         RK-DRRQKYLTGGLVNLADNLVKKRGHNSIIGHEKTNALETLKKKKKRNN

                               .      .               ..     .          :. : 

 

gi|18202876|M.M._DDX24      PPQPGSSTS---------------------------------

gi|18202929|H.S.DDX24       QPQPSTSAN---------------------------------

gi|7504318|C.E._Mak5        TREDEMNSMKKSLKSSQKNKERLAEKKKKEKAAKVTKLSETD

gi|33636633|D.M.Mak5        ------------------------------------------

gi|536442|S.C._MAK5         ------------------------------------------