S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Has1p
YMR290C
B0511.6 CG6375 DDX18 DDX18
MrdB
Database Links
Cellular Function Ribosome biogenesis

Group Alignment

gi|7022744|dbj|BAA91709.1|        MSHLPMKLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGS

gi|31981163|ref|NP_080136.2|      MSQLQMKLLRRKIEKRNAKLRQRNLKLQETSDTSLSQPQNGDVPKETGKG

gi|15375231|gb|AAC17654.2|        --------------------------------------------------

gi|33860195|sp|Q9VD51|            MSIREKLLMKKIVKREKMKKELSQKKGNKNAQKQEPPKQNGNKPSK----

gi|6323947|ref|NP_014017.1|       --------------------------------------------------

                                                                                    

 

gi|7022744|dbj|BAA91709.1|        RKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAM

gi|31981163|ref|NP_080136.2|      GKVKKALKRSVPVDSAEAQSGGMPEETLENGKVKKSPQKLTTLANGEAAP

gi|15375231|gb|AAC17654.2|        ----------MGIDVKK--------------KVLKR--KLKQMKDG----

gi|33860195|sp|Q9VD51|            -KPEKLSKKHVAKDEDDDLEEDFQEAPLPKKKQQKQPPKKQQIQVANSDS

gi|6323947|ref|NP_014017.1|       --------------------------------------MATP--------

                                                                                    

 

gi|7022744|dbj|BAA91709.1|        QSS-NSESKKKKKKK--RKMVNDAEPDTKKAKTENKGKSEEESAE-----

gi|31981163|ref|NP_080136.2|      TPPPDSEVKKKKKKK--RKMANDAGPDTKKAKT-------EESAE-----

gi|15375231|gb|AAC17654.2|        --------HEKKKAK--EVVVEEPMEE-------------EDEEE-----

gi|33860195|sp|Q9VD51|            ESDDDEQEDEADEDSDLDEVAEVDEEDVDSGSEDDDQQEDEDEEEPVPAK

gi|6323947|ref|NP_014017.1|       -------SNKRSRDS---ESTEEPVVD-------------EKSTS-----

                                          .: .. .     .:    :             *.. .    

 

gi|7022744|dbj|BAA91709.1|        -----TTKETENNVEKPDNDEDESEVPSLPLGLTGAFEDTSFASLCNLVN

gi|31981163|ref|NP_080136.2|      -----ACEEPEDDVKKAD----DSEVPSLPLGLTGAFEDTSFASLSNLVN

gi|15375231|gb|AAC17654.2|        -----VEEEQKHQTEESS----ETKVSEF-------LTKTTFASLEGKVN

gi|33860195|sp|Q9VD51|            KTKLLPNKSKAQNGKPAKDDEPFTVESSLAALDYRDSDDRSFASLKGAVS

gi|6323947|ref|NP_014017.1|       -----KQNNAAPEGEQTT-------------------CVEKFEELK--LS

                                         :.   : : .                       .* .*   :.

 

gi|7022744|dbj|BAA91709.1|        ENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPA

gi|31981163|ref|NP_080136.2|      ENTLKAIEEMGFKRMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPV

gi|15375231|gb|AAC17654.2|        ANLLKAVQGLGFTTMTEIQAKSIDPLLEGKDVLASAKTGSGKTLAFLLPA

gi|33860195|sp|Q9VD51|            EATLRAIKEMGFTEMTEIQSKSLTPLLKGRDLVGAAQTGSGKTLAFLIPA

gi|6323947|ref|NP_014017.1|       QPTLKAIEKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPA

                                     *:*:: :**. **.:* ::: *** *:*::.:*:**********:*.

 

gi|7022744|dbj|BAA91709.1|        VELIVKLRFMTRNGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMG

gi|31981163|ref|NP_080136.2|      IELIVKLKFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMG

gi|15375231|gb|AAC17654.2|        IELLHKLNWKQHNGTGVIIVSPTRELSMQTYGVLSELLEGSNLTYGLVMG

gi|33860195|sp|Q9VD51|            VELINKLRFMPRNGTGVIIISPTRELSMQTFGVLKELMAHHHHTYGLVMG

gi|6323947|ref|NP_014017.1|       IELLHSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIG

                                  :**: .*.:  :****:::::*****::* :**  **:     *:*:::*

 

gi|7022744|dbj|BAA91709.1|        GSNRSAEAQKLGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADR

gi|31981163|ref|NP_080136.2|      GSNRSAEVQKLLNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADR

gi|15375231|gb|AAC17654.2|        GSNRSAEKDKLAKGVSILVATPGRLLDHLQNTDNFLVRNMKCLIIDEADR

gi|33860195|sp|Q9VD51|            GSNRQVESEKLGKGINILVATPGRLLDHLQNSPDFLYKNLQCLIIDEVDR

gi|6323947|ref|NP_014017.1|       GANRRQEAEKLMKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADR

                                  *:**  * :** :*:.:::*********:**: .*: :*::.*:***.**

 

gi|7022744|dbj|BAA91709.1|        ILDVGFEEELKQIIKLLPTR-RQTMLFSATQTRKVEDLARISLKKEPLYV

gi|31981163|ref|NP_080136.2|      ILDVGFEEELKQIIKLLPAR-RQTMLFSATQTRKVEDLARISLKKEPLYV

gi|15375231|gb|AAC17654.2|        ILDIGFEIEMQQVLRHLPKQ-RQSMLFSATHSPKVDELVKLALHSNPVRV

gi|33860195|sp|Q9VD51|            ILEIGFEEELKQIINLLPKR-RQTMLFSATQTARIEALSKLALKSEPIYV

gi|6323947|ref|NP_014017.1|       ILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLRPGPLFI

                                  **::*** *::*::. ** . **:******:: ::: * :::*:  *: :

 

gi|7022744|dbj|BAA91709.1|        GVDDDKANATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKLMVFFSSCM

gi|31981163|ref|NP_080136.2|      GVDDDKEVATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKVMVFFSSCM

gi|15375231|gb|AAC17654.2|        SVHEKAEEATVEGLQQGYIVAPSDKRLLLLFTFLKKNKTKKVMVFFSSCN

gi|33860195|sp|Q9VD51|            GVHDNQDTATVDGLEQGYIVCPSEKRLLVLFTFLKKNRKKKVMVFFSSCM

gi|6323947|ref|NP_014017.1|       NVVPETDNSTADGLEQGYVVCDSDKRFLLLFSFLKRNQKKKIIVFLSSCN

                                  .*  .   :*.:**:***:*. *:**:*:**:***:*:.**::**:***

 

gi|7022744|dbj|BAA91709.1|        SVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGTLLCTDVAA

gi|31981163|ref|NP_080136.2|      SVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGILLCTDVAA

gi|15375231|gb|AAC17654.2|        SVKFHHELLNYIDIPCMSIHGKQKQQKRTTTFFQFCQAETGILLCTDVAA

gi|33860195|sp|Q9VD51|            SVKYHHELFNYIDLPVTSIHGKQKQTKRTTTFFQFCNAESGILLCTDVAA

gi|6323947|ref|NP_014017.1|       SVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAA

                                  ***:: **:****:*   :****** ***.***:**:*: * *:******

 

gi|7022744|dbj|BAA91709.1|        RGLDIPEVDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALLILRPEELG

gi|31981163|ref|NP_080136.2|      RGLDIPEVDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALLILRPEELG

gi|15375231|gb|AAC17654.2|        RGLDIPAVDWIVQYDPTDEPREYIHRVGRTARGTNGSGKALLVLRPEELG

gi|33860195|sp|Q9VD51|            RGLDIPQVDWIVQYDPPDDPREYIHRVGRTARGSGTSGHALLLMRPEELG

gi|6323947|ref|NP_014017.1|       RGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTKGKGKSLMFLTPNELG

                                  ****** ****:*:**.*:*::***********    *::*:.: *:***

 

gi|7022744|dbj|BAA91709.1|        FLRYLKQSKVPLSEFDFSWSKISDIQSQLEKLIEKNYFLHKSAQEAYKSY

gi|31981163|ref|NP_080136.2|      FLRYLKQSKVPLNQFDFSWSKVSDIQSQLEKLIEKNYFLHKSAQEAYKSY

gi|15375231|gb|AAC17654.2|        FLRYLKAAKVTLNEFEFSWSKVANIQSQLENLISKNYYLNKSAKEAYKCY

gi|33860195|sp|Q9VD51|            FLRYLKAAKVPLNEFEFSWQKIADIQLQLEKLIAKNYFLNQSAKEAFKSY

gi|6323947|ref|NP_014017.1|       FLRYLKASKVPLNEYEFPENKIANVQSQLEKLIKSNYYLHQTAKDGYRSY

                                  ****** :**.*.:::*. .*::::* ***:** .**:*:::*::.::.*

 

gi|7022744|dbj|BAA91709.1|        IRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPFVDLNVNSNEGKQ-KKR

gi|31981163|ref|NP_080136.2|      IRAYDSHSLKQIFNVNNLNLPQVALSFGFKVPPFVDLNVSSHDGKL-KKR

gi|15375231|gb|AAC17654.2|        LRAYDSHSLKDIFDVTNMDLTAVSKSFGFSVPPFVDLPIS-NKPKV-EIR

gi|33860195|sp|Q9VD51|            VRAYDSHQLKQIFNVNTLDLQAVAKSFGFLVPPVVDLKVGAAKRERPEKR

gi|6323947|ref|NP_014017.1|       LQAYASHSLKTVYQIDKLDLAKVAKSYGFPVPPKVNITIGASGKTPNTKR

                                  ::** **.** :::: .::*  *: *:** *** *:: :.         *

 

gi|7022744|dbj|BAA91709.1|        GGGGGFG-YQKTKKVEKSKIFKHISKKSSDSRQFSH

gi|31981163|ref|NP_080136.2|      GGGGGFG-YQKTKKVEKSKIFKHISKKPADRRQFSH

gi|15375231|gb|AAC17654.2|        SKLSGAG-YRKKKQS-----FTFKAKK---------

gi|33860195|sp|Q9VD51|            VGGGGFGFYKKMNEGSASKQRHFKQVNRDQAKKFMR

gi|6323947|ref|NP_014017.1|       R---------KTHK----------------------

                                            * ::