S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein DDX20
Gemin-3
DDX20
Gemin-3
Database Links
Cellular Function RNP biogenesis

Group Alignment

Q9UHI6|DDX20_HUMAN      -PADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTI
Q9JJY4|DDX20_MOUSE      EPADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTI
                         ***********************************************************
 
Q9UHI6|DDX20_HUMAN      ALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLK
Q9JJY4|DDX20_MOUSE      ALDSLILENYSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLK
                        *****:*** **************************************************
 
Q9UHI6|DDX20_HUMAN      KCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQM
Q9JJY4|DDX20_MOUSE      KCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEHINWIYSSLPASKQM
                        *********************************************:**************
 
Q9UHI6|DDX20_HUMAN      LAVSATYPEFLANALTKYMRDPTFVRLNSSDPSLIGLKQYYKVVNSYPLAHKVFEEKTQH
Q9JJY4|DDX20_MOUSE      LAVSATYPEVLANALTRYMRDPTFVRLNPSDPSLIGLKQYYQVVNSYPLAHKIFEEKTQH
                        *********.******:***********.************:**********:*******
 
Q9UHI6|DDX20_HUMAN      LQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQRLDAMAKLKHFH
Q9JJY4|DDX20_MOUSE      LQELFSKVPFNQALVFSNLHSRAQHLADILSSKGFPTECISGNMNQNQRLDAMAKLKQFH
                        ******::****************************:********************:**
 
Q9UHI6|DDX20_HUMAN      CRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEE
Q9JJY4|DDX20_MOUSE      CRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEE
                        ************************************************************
 
Q9UHI6|DDX20_HUMAN      NMMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKI
Q9JJY4|DDX20_MOUSE      NMMMKIAQKCNINLLPLPDPIPPGLMEECLNWDVEVKAAMHTYSSPTVATQSPKKQVQKL
                        ****:*****************.******::********:***. .:*..*. ***:**:
 
Q9UHI6|DDX20_HUMAN      ERTLQIQKAHGDHMASSRNNSVSGLSVKSKNNTKQKLPVKSHSECGIIEKATSPKELGCD
Q9JJY4|DDX20_MOUSE      ERAFQSQRTPGNQTPSPRNTSASALSAR-PKHSKPKLPVKSHSECGVLEKAAPPQESGCP
                        **::* *:: *:: .*.**.*.*.**.:  :::* ***********::***:.*:* ** 
 
Q9UHI6|DDX20_HUMAN      RQSEEQMKNSVQTPVEN-STNSQHQVKEALPVSLPQIPCLSSFKIHQPYTLTFAELVEDY
Q9JJY4|DDX20_MOUSE      AQLEEQVKNSVQTSVEDSSSNSQHQAKDSSPGSLPKIPCLSSFKVHQPSTLTFAELVDDY
                         * ***:******.**: *:*****.*:: * ***:********:*** ********:**
 
Q9UHI6|DDX20_HUMAN      EHYIKEGLEKPVEIIRHYTGPGDQTVNPQNGFVRNKVIEQRVPVLASSSQSGDSESDSDS
Q9JJY4|DDX20_MOUSE      EHYIKEGLEKPVEIIRHYTGPEAQTGNPQNGFVRNRVSEDRAQMLVSSSQSGDSESDSDS
                        *********************  ** *********:* *:*. :*.**************
 
Q9UHI6|DDX20_HUMAN      YSSRTSSQSKGNKSYLEGSSDNQLKDSESTPVDDRISLEQPPNGSDTPNPEKYQESPGIQ
Q9JJY4|DDX20_MOUSE      CSSRTSSQSKGNKSYLEGSSDTQLKDTECTPVGGPLSLEQVQNGNDTPTQVEYQEAPETQ
                         ********************.****:*.***.. :****  **.***.  :***:*  *
 
Q9UHI6|DDX20_HUMAN      MKTRLKEGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWR
Q9JJY4|DDX20_MOUSE      VKARHKEGANQRSKQSRRNPARRSSYRVQSEPQEESWYDCHRETTASFSDTYQDYEEYWR
                        :*:* ****.**:****** .****:*:*:*.**:.*******   **************
 
Q9UHI6|DDX20_HUMAN      AYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ
Q9JJY4|DDX20_MOUSE      AYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTVYLQEMMRGNQ
                        ***********************************:******:.**