S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Fal1p
YDR021W
F33D11.10 eIF4AIII
CG7483
eIF4AIII
DDX48
eIF4AIII
DDX48
Database Links
Cellular Function Ribosome biogenesis
  • pre-mRNA splicing
  • RNA export
  • Translation
  • RNA decay
  • (Component of Exon Junction Complex)

Group Alignment

Q12099|FAL1_YEAST.              MSFDREEDQKLKFKTSKKLKVSSTFESMNLKDDLLRGIYSYGFEAPSSIQ
P38919|IF4A3_HUMAN.             ---------------------------------------------PSAIQ
Q91VC3|IF4A3_MOUSE.             ---------------------------------------------PSAIQ
O44781|IF4A3_O44781_CAEEL.      --------------------------------------------------
Q9VHS8|IF4A3_Q9VHS8_DROME.      --------------------------------------------------
                                                                                  
 
Q12099|FAL1_YEAST.              SRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLRKKDLQALILSPT
P38919|IF4A3_HUMAN.             QRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPT
Q91VC3|IF4A3_MOUSE.             QRAIKQIIKGRDVIAQSQSGTGKTATFSVSVLQCLDIQVRETQALILAPT
O44781|IF4A3_O44781_CAEEL.      -------LKARDVIAQAQSGTGKTATFSISVLQSLDTQVRETQALILSPT
Q9VHS8|IF4A3_Q9VHS8_DROME.      -------VKGRDVIAQAQSGTGKTATFSISILQSLDTTLRETQVLCLSPT
                                       :..:*****:**********::.:**.:*   :: *.* *:**
 
Q12099|FAL1_YEAST.              RELASQIGQVVKNLGDYMNVNAFAITGGKTLKDDLKKMQKHGCQAVSGTP
P38919|IF4A3_HUMAN.             RELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYG-QHVVAGTP
Q91VC3|IF4A3_MOUSE.             RELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYG-QHVVAGTP
O44781|IF4A3_O44781_CAEEL.      RELAVQIQKVVLALGDYMNVQCHACIGGTNLGEDIRKLDYG-QHVVSGTP
Q9VHS8|IF4A3_Q9VHS8_DROME.      RELAVQIQKVILALGDMMNVQCHVCIGGTNLGEDIRKLDYG-QHIVSGTP
                                **** ** : :  *** ***:...  **..: :*::*::    : *:***
 
Q12099|FAL1_YEAST.              GRVLDMIKKQMLQTRNVQMLVLDEADELLSETLGFKQQIYDIFAKLPKNC
P38919|IF4A3_HUMAN.             GRVFDMIRRRSLRTRAIKMLVLDEADEMLNK--GFKEQIYDVYRYLPPAT
Q91VC3|IF4A3_MOUSE.             GRVFDMIRRRSLRTRAIKMLVLDEADEMLNK--GFKEQIYDVYRYLPPAT
O44781|IF4A3_O44781_CAEEL.      GRVFDMIRRRNLRTRAIKLLVLDEADEMLNK--GFKEQLYDIYRYLPPGA
Q9VHS8|IF4A3_Q9VHS8_DROME.      GRVFDMIKRRVLRTRAIKMLVLDEADEMLNK--GFKEQIYDVYRYLPPAT
                                ***:***::: *:** :::********:*.:  ***:*:**::  **   
 
Q12099|FAL1_YEAST.              QVVVVSATMNKDILEVTRKFMNDPVKILVKRDEISLEGIKQYVVNVDKEE
P38919|IF4A3_HUMAN.             QVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREE
Q91VC3|IF4A3_MOUSE.             QVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREE
O44781|IF4A3_O44781_CAEEL.      QVVLLSATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVDREE
Q9VHS8|IF4A3_Q9VHS8_DROME.      QVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVEREE
                                ***::***: ::***:* ***.**::*******::******:.* *::**
 
Q12099|FAL1_YEAST.              WKFDTLCDIYDSLTITQCVIFCNTKKKVDWLSQRLIQSNFAVVSMHGDMK
P38919|IF4A3_HUMAN.             WKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP
Q91VC3|IF4A3_MOUSE.             WKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP
O44781|IF4A3_O44781_CAEEL.      WKFDTLIDLYDTLTITQAVLFCNTRRKVDWLTDKMKEANFTVSSMHGDME
Q9VHS8|IF4A3_Q9VHS8_DROME.      WKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMP
                                ****** *:**:*****.*:****::*****:::: ::**:* ****** 
 
Q12099|FAL1_YEAST.              QEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPEIIENYI
P38919|IF4A3_HUMAN.             QKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYI
Q91VC3|IF4A3_MOUSE.             QKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYI
O44781|IF4A3_O44781_CAEEL.      QKDRDEVMKEFRAGTTRVLISTDVWARGLDVPQVSLVINYDLPNNRELYI
Q9VHS8|IF4A3_Q9VHS8_DROME.      QKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYI
                                *::*:.:*::**:* :****:*******:** ****:******:  * **
 
Q12099|FAL1_YEAST.              HRIGRSGRFGRKGVAINFITKADLAKLREIEKFYSIKINPMPANFAELS
P38919|IF4A3_HUMAN.             HRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI
Q91VC3|IF4A3_MOUSE.             HRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI
O44781|IF4A3_O44781_CAEEL.      HRIGRSGRFGRKGVAINFVKQDDVRILRDIEQYYSTQIDEMPMNIADII
Q9VHS8|IF4A3_Q9VHS8_DROME.      HRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPMNVADLI
                                ********:*********:.. *:  **:**::** :*: ** *.*::