S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Tif1p / YKR059W
Tif2p / YJL138C
eIF4A
F57B9.6
CG9075 eIF4A-I
DDX2A
eIF4A-I
DDX2A
Database Links
Protein eIF4A-II
DDX2B
eIF4A-II
DDX2B
Database Links
Cellular Function Translation Initiation Translation Initiation

Group Alignment

sp|P60842|IF4A1_HUMAN      -MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYA
sp|P60843|IF4A1_MOUSE      -MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYA
Q14240|IF4A2_HUMAN         MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYA
P10630|IF4A2_MOUSE         MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYA
P27639|IF4A_CAEEL          ----MTDVKNDVNVSSVVDADGLIEGNYDQVVESFDDMELKEELLRGIYG
sp|Q02748|IF4A_DROME       ---MDDRNEIPQDGPASMEPEGVIESTWHEVYDNFDDMNLREELLRGIYG
Tif1 S.c.                  -----------MSEGITDIEESQIQTNYDKVVYKFDDMELDENLLRGVFG
Tif2 S.c.                  -----------MSEGITDIEESQIQTNYDKVVYKFDDMELDENLLRGVFG
                                       .       :. *: .:.::  .****:* *.****::.
 
sp|P60842|IF4A1_HUMAN      YGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLK
sp|P60843|IF4A1_MOUSE      YGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLK
Q14240|IF4A2_HUMAN         YGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFK
P10630|IF4A2_MOUSE         YGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFK
P27639|IF4A_CAEEL          FGFEKPSAIQKRAIVPCTTGKDVIAQAQSGTGKTATFSVSILQRIDHEDP
sp|Q02748|IF4A_DROME       YGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQIDTSIR
Tif1 S.c.                  YGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVK
Tif2 S.c.                  YGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVK
                           :***:*****:***:*   * **:**********.**::: **::: .  
 
sp|P60842|IF4A1_HUMAN      ATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQM
sp|P60843|IF4A1_MOUSE      ATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQM
Q14240|IF4A2_HUMAN         ETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQA
P10630|IF4A2_MOUSE         ETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQA
P27639|IF4A_CAEEL          HVQALVMAPTRELAQQIQKVMSALGEYLNVNILPCIGGTSVR-DDQRKLE
sp|Q02748|IF4A_DROME       ECQALILAPTRELATQIQRVVMALGEYMKVHSHACIGGTNVR-EDARILE
Tif1 S.c.                  APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEG--L
Tif2 S.c.                  APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEG--L
                             ***::******* ***:*: **. ::     .*****..  :      
 
sp|P60842|IF4A1_HUMAN      EAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDI
sp|P60843|IF4A1_MOUSE      EAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDI
Q14240|IF4A2_HUMAN         EAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEI
P10630|IF4A2_MOUSE         EAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEI
P27639|IF4A_CAEEL          AGIHVVVGTPGRVGDMINRNALDTSRIKMFVLDEADEMLSRGFKDQIYEV
sp|Q02748|IF4A_DROME       SGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEMLSRGFKDQIQDV
Tif1 S.c.                  RDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQI
Tif2 S.c.                  RDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQI
                              :::******* * ::*. : .. **:*:********* ***:** ::
 
sp|P60842|IF4A1_HUMAN      FQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQF
sp|P60843|IF4A1_MOUSE      FQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQF
Q14240|IF4A2_HUMAN         FQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQF
P10630|IF4A2_MOUSE         FQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQF
P27639|IF4A_CAEEL          FRSMPQDVQVVLLSATMPSEVLDVTNRFMRNPIRILVKKDELTLEGIRQF
sp|Q02748|IF4A_DROME       FKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQF
Tif1 S.c.                  FTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQF
Tif2 S.c.                  FTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQF
                           *  :    **:******* :**:*:  ***:*: *****:*******:**
 
sp|P60842|IF4A1_HUMAN      YINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTV
sp|P60843|IF4A1_MOUSE      YINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTV
Q14240|IF4A2_HUMAN         YINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTV
P10630|IF4A2_MOUSE         YINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDWLTEKMHARDFTV
P27639|IF4A_CAEEL          YINVQKDEWKFDCLCDLYNVVNVTQAVIFCNTRRKVDTLTEKMTENQFTV
sp|Q02748|IF4A_DROME       YVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTV
Tif1 S.c.                  YVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTV
Tif2 S.c.                  YVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTV
                           *:**:.:::*   * ***: :.:**:*** ******: ** ::   .***
 
sp|P60842|IF4A1_HUMAN      SAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDL
sp|P60843|IF4A1_MOUSE      SAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDL
Q14240|IF4A2_HUMAN         SALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDL
P10630|IF4A2_MOUSE         SALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDL
P27639|IF4A_CAEEL          SCLHGDMDQAERDTIMREFRSGSSRVLITTDILARGIDVQQVSLVINYDL
sp|Q02748|IF4A_DROME       SAMHGDMEQRDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDL
Tif1 S.c.                  SAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL
Tif2 S.c.                  SAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDL
                           *.::.*: * :*:.**::*******:**:**:******************
 
sp|P60842|IF4A1_HUMAN      PTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMP
sp|P60843|IF4A1_MOUSE      PTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMP
Q14240|IF4A2_HUMAN         PTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMP
P10630|IF4A2_MOUSE         PTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMP
P27639|IF4A_CAEEL          PSNRENYIHRIGRSGRFGRKGVAINFVTENDARQLKEIESYYTTQIEEMP
sp|Q02748|IF4A_DROME       PSNRENYIHRIGRGGRFGRKGVAINFITDDDRRILKDIEQFYHTTIEEMP
Tif1 S.c.                  PANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELP
Tif2 S.c.                  PANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELP
                           *:*:*********.***********::*::*   ::::* :* * :**:*
 
sp|P60842|IF4A1_HUMAN      LNVADLI-------------------------------------------
sp|P60843|IF4A1_MOUSE      LNVADLI-------------------------------------------
Q14240|IF4A2_HUMAN         MNVADLI-------------------------------------------
P10630|IF4A2_MOUSE         MNVADLI-------------------------------------------
P27639|IF4A_CAEEL          ESIADLI-------------------------------------------
sp|Q02748|IF4A_DROME       ANIADLI-------------------------------------------
Tif1 S.c.                  SDIATLLN------------------------------------------
Tif2 S.c.                  SDIATLLN------------------------------------------
                            .:* *: