S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Drs1p
YLL008W
Y71G12B.8 CG2173 DDX27 DDX27
Database Links
Cellular Function Ribosome Biogenesis

Group Alignment

gi|15030137|gb|AAH11321.1|          --------------------------------------------------

gi|29427946|sp|Q96GQ7|DDX27_HU      MVLAQRRRGGCEKLRAGPQAVLASGSGFCDNMLADLGLIGTIGEDDEVPV

gi|7304081|gb|AAF59119.1|           -----------------------------MGATKNLDLIGTIEDDAEVEN

gi|17510559|ref|NP_490891.1|        ---------------------------------------MEIDESDDEQV

gi|6323021|ref|NP_013093.1|         ---------------MVVGTKKYSNLDFVPTISDSEDDVPILDSSDDEKV

                                                                                      

 

gi|15030137|gb|AAH11321.1|          --------------------------------------------------

gi|29427946|sp|Q96GQ7|DDX27_HU      EPESDSGDEEEEGPIVLGRRQKALGKNRSADFNPDFVFTEKEGTYDGSWA

gi|7304081|gb|AAF59119.1|           LSE-DSDAEVEYQP-------TKLRHKKVTEFEKGFEFVSSVKEYN----

gi|17510559|ref|NP_490891.1|        QDEAVTVRK------------KKKMANAAEEFAQDFIFESGDTQFI----

gi|6323021|ref|NP_013093.1|         EAKKTTKKRKGKNNKKKVSEGDNLDEDVHEDLDAGFKFDLDADDTTSNFQ

                                                                                      

 

gi|15030137|gb|AAH11321.1|          --------------------------------------------------

gi|29427946|sp|Q96GQ7|DDX27_HU      ----------------------------LADVMSQLKKKRAATTLDEKIE

gi|7304081|gb|AAF59119.1|           -----------------------------------------QDTWDDLMK

gi|17510559|ref|NP_490891.1|        -----------------------------------------DRETEDLQK

gi|6323021|ref|NP_013093.1|         GWNFLAEGESNKDDAEAFVKKDVDLDKIIRRKGGLVKMAHIDSKQEEETE

                                                                                      

 

gi|15030137|gb|AAH11321.1|          --------------------------------------------------

gi|29427946|sp|Q96GQ7|DDX27_HU      KVRKKRKTEDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASE

gi|7304081|gb|AAF59119.1|           YVKRKARTKTDDKIAARLQK----RGGAEAVAAEQSDGSEIDLSEDELKH

gi|17510559|ref|NP_490891.1|        YLKKQTPTSLDEKIAEMRKLKN--TGKAVIVEDEAEAAEAEEKDEEEDDV

gi|6323021|ref|NP_013093.1|         KEKVEKENDSDDEELAMDGFGMGAPMNNGDENQSEEEEEEEEKEEEEEEE

                                                                                     

 

gi|15030137|gb|AAH11321.1|          --------------------------------------------------

gi|29427946|sp|Q96GQ7|DDX27_HU      TDYSSADENILTKADTLKVKDRKKKKKKGQEAGGFFEDASQYDENLSFQD

gi|7304081|gb|AAF59119.1|           DNLRLREK---KESKKKKKKAGEEDEEDEGEKMQFADTVEANEQITSFYQ

gi|17510559|ref|NP_490891.1|        QQLGGKETRDTVREKRKSGKSKKSQENEDFFSALIDGKSLDTSVNVSFEQ

gi|6323021|ref|NP_013093.1|         EEQEEMTLEKGGKDDEIDEEDDSEEAKADFYAPETEGDEAKKQMYENFNS

                                                                                     

 

gi|15030137|gb|AAH11321.1|          MNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAF

gi|29427946|sp|Q96GQ7|DDX27_HU      MNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAF

gi|7304081|gb|AAF59119.1|           MNLSRPLMRAIGVLGYIYPTPIQASTIPVALLGRDICGCAATGTGKTAAY

gi|17510559|ref|NP_490891.1|        MNLSRQILKACSGAGYSDPTPIQQACIPVALTGKDICACAATGTGKTAAF

gi|6323021|ref|NP_013093.1|         LSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAF

                                    :.*** :::.    *:  *:*** : **:.* *:** . *.**:*****:

 

gi|15030137|gb|AAH11321.1|          ALPVLERLIYKPRQ-AAVTRVLVLVPTRELGIQVHSVTKQLAQFCS-ITT

gi|29427946|sp|Q96GQ7|DDX27_HU      ALPVLERLIYKPRQ-APVTRVLVLVPTRELGIQVHSVTRQLAQFCN-ITT

gi|7304081|gb|AAF59119.1|           MLPTLERLLYRPLNNKAITRVLVLVPTRELGAQVYQVTKQLCQFTT-IDV

gi|17510559|ref|NP_490891.1|        VLPILERMIYRPKG-ASCTRVLVLVPTRELAIQVFQVFRKLSTFIQ-LEV

gi|6323021|ref|NP_013093.1|         MIPIIERLLYKPAK-IASTRVIVLLPTRELAIQVADVGKQIARFVSGITF

                                     :* :**::*:*    . ***:**:*****. ** .* :::. *   : 

 

gi|15030137|gb|AAH11321.1|          CLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFHLS-------

gi|29427946|sp|Q96GQ7|DDX27_HU      CLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFHLS-------

gi|7304081|gb|AAF59119.1|           GLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSFTLD-------

gi|17510559|ref|NP_490891.1|        CLCAGGLDLKAQEAALRSGPDVVVATPGRLIDHLHNSPSFNLSNIEVFFK

gi|6323021|ref|NP_013093.1|         GLAVGGLNLRQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVD-------

                                     *. ***::: **  *:  **:::*****:***::* .** :.      

 

gi|15030137|gb|AAH11321.1|          -----------------SIEVLILDEADKMLDEYFEEQMKEIIRMCSHHR

gi|29427946|sp|Q96GQ7|DDX27_HU      -----------------SIEVLILDEADRMLDEYFEEQMKEIIRMCSHHR

gi|7304081|gb|AAF59119.1|           -----------------SIEVLILDEADRMLDEYFAEQMKEIINSCCKTR

gi|17510559|ref|NP_490891.1|        TPNIPPKKNSRKICKIPNFQVLVLDEADRMLEEAFRDQMNELIRLCAQNR

gi|6323021|ref|NP_013093.1|         -----------------SVEILVMDEADRMLEEGFQDELNEIMGLLPSNR

                                                     ..::*::****:**:* * ::::*::      *

 

gi|15030137|gb|AAH11321.1|          QTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNR

gi|29427946|sp|Q96GQ7|DDX27_HU      QTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNR

gi|7304081|gb|AAF59119.1|           QTMLFSATMSEQVKDLAAVSLDKPIKVFVNNNQQVAFNLRQEFIRIREDK

gi|17510559|ref|NP_490891.1|        QTLLFSATMTEEIDELASMSLQKPVKIFINENTDTALKLRQEFIRIRAGR

gi|6323021|ref|NP_013093.1|         QNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRK-R

                                    *.:******..::..*.::**.:*::::::   ..*  * ***:***  :

 

gi|15030137|gb|AAH11321.1|          EGDREAIVAALLMR---TFTDHVMLFTQTKKQAHRMHILLGLLGLQVGEL

gi|29427946|sp|Q96GQ7|DDX27_HU      EGDREAIVAALLTR---TFTDHVMLFTQTKKQAHRMHILLGLMGLQVGEL

gi|7304081|gb|AAF59119.1|           EGDREPILASLICR---TFHDHCMVFVQTKKQAHRLHILLGLLGVRAGEL

gi|17510559|ref|NP_490891.1|        ETDREAMVAALVTR---TFQTNTIVFVRTKKDCQRMQILLGLLGIKVGQM

gi|6323021|ref|NP_013093.1|         DHLKPALLFNLIRKLDPTGQKRIVVFVARKETAHRLRIIMGLLGMSVGEL

                                    :  : .::  *: :   *   . ::*.  *: .:*::*::**:*: .*::

 

gi|15030137|gb|AAH11321.1|          HGNLSQTQRLEALRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNT

gi|29427946|sp|Q96GQ7|DDX27_HU      HGNLSQTQRLEALRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNT

gi|7304081|gb|AAF59119.1|           HGNLTQQQRLESLKKFKEEQIDVLIATDVAARGLDIVGVKTVINFVMPIT

gi|17510559|ref|NP_490891.1|        QSSLTQGQRIESLSKFKKAEIDVLVSTDLASRGLDIEGVQTVINMNMPKS

gi|6323021|ref|NP_013093.1|         HGSLTQEQRLDSVNKFKNLEVPVLICTDLASRGLDIPKIEVVINYDMPKS

                                    :..*:* **:::: :**. :: :*:.**:*:*****  ::.***  ** :

 

gi|15030137|gb|AAH11321.1|          VKHYVHRVGRTARAGRAGRSVSLVGE--EERKMLKEIVKA-------AKA

gi|29427946|sp|Q96GQ7|DDX27_HU      IKHYVHRVGRTARAGRAGRSVSLVGE--DERKMLKEIVKA-------AKA

gi|7304081|gb|AAF59119.1|           TEHYIHRVGRTARAGRAGISVSLAGE--KERKIVKDIIKN-------AES

gi|17510559|ref|NP_490891.1|        IKQYIHRVGRTARAGKAGRSISLVGE--DERKLLKEIVNSN------ADR

gi|6323021|ref|NP_013093.1|         YEIYLHRVGRTARAGREGRSVTFVGESSQDRSIVRAAIKSVEENKSLTQG

                                     : *:**********: * *:::.**  .:*.:::  ::        :.

 

gi|15030137|gb|AAH11321.1|          PVKARILPQDVILKFRDKIEKLEKDVYAVLQLEAEEKEMQQSEAQIDTAQ

gi|29427946|sp|Q96GQ7|DDX27_HU      PVKARILPQDVILKFRDKIEKMEKDVYAVLQLEAEEKEMQQSEAQINTAK

gi|7304081|gb|AAF59119.1|           TIKNRIIPPEIIEKYRNKLTSLEPEIQNILDEEQAERQLAKTEQQLSKTE

gi|17510559|ref|NP_490891.1|        TLKQRLVAPEVVEAYRRRIDELEETIQQIDEEDRAEKELRIAEASMAKTQ

gi|6323021|ref|NP_013093.1|         KALGRNVDWVQIEETNKLVESMNDTIEDILVEEKEEKEILRAEMQLRKGE

                                        * :    :   .  : .::  :  :   :  *:::  :* .: . :

 

gi|15030137|gb|AAH11321.1|          RLLAKGKETADQEPERSWFQTKEER--KKEKIAKALQEFDLALRGKKK--

gi|29427946|sp|Q96GQ7|DDX27_HU      RLLEKGKEAVVQEPERSWFQTKEER--KKEKIAKALQEFDLALRGKKK--

gi|7304081|gb|AAF59119.1|           RKLLG-----QTNERRGWFQTKQQREAEKDRLALTTGDEDKASGGKGKGK

gi|17510559|ref|NP_490891.1|        NALEVGENGGAPAERRVWMMKESQIEKQRKREEKRQMKVD----------

gi|6323021|ref|NP_013093.1|         -NMLKHKKEIQARPRRTWFQSESDKKNSKVLGALS---------------

                                      :           .* *: .:.:   .:                    

 

gi|15030137|gb|AAH11321.1|          ----------------------------RKKFMKDAKKKGEMTAEERSQF

gi|29427946|sp|Q96GQ7|DDX27_HU      ----------------------------RKKFMKDAKKKGEMTAEERSQF

gi|7304081|gb|AAF59119.1|           TAGKRKRPEYGGDGEDGPPVKDLEAKRNKKKKEEPRKKTPEQLAKERAMK

gi|17510559|ref|NP_490891.1|        ----------------------------ARKKAEAAKTPEDIQIEHEAAF

gi|6323021|ref|NP_013093.1|         ----------------------------RNKKVTNSKKRKREEAKADGNG

                                                                 .*     *.      :  . 

 

gi|15030137|gb|AAH11321.1|          EILKAQMFAERLAKRNRRTKRARAMPEDEPT-GPAKKQKQ-QQKSVFDEE

gi|29427946|sp|Q96GQ7|DDX27_HU      EILKAQMFAERLAKRNRRAKRARAMPEEEPVRGPAKKQKQ-GKKSVFDEE

gi|7304081|gb|AAF59119.1|           EIEKVSLVRAKMAKLRKRPGKLGAATEVHRSGASDGKPKRRGGQSAFTND

gi|17510559|ref|NP_490891.1|        HVRAAKRARHSKNKRIRAVVESAGTKGAGKAAQNKKKASSNSKTSLRDIP

gi|6323021|ref|NP_013093.1|         ARSYRKTKTDRIADQERTFKKQKSTNSNKKKGFKSRR-------------

                                         .       .  :   .  .            :            

 

gi|15030137|gb|AAH11321.1|          LTNTSKKALKQYRAGP----------------SFEERKQSGLPRQRRG-N

gi|29427946|sp|Q96GQ7|DDX27_HU      LTNTSKKALKQYRAGP----------------SFEERKQLGLPHQRRGGN

gi|7304081|gb|AAF59119.1|           LTDVSRGGALRLRSEANRHKKMTKIAAKKKASSVKLTNKAGKNKFNKGKN

gi|17510559|ref|NP_490891.1|        LVNAGSRGVQKAQKGQ---KPGAKKGFTSALASVSKKSVKAARHGPEDSK

gi|6323021|ref|NP_013093.1|         --------------------------------------------------

                                                                                     

 

gi|15030137|gb|AAH11321.1|          FKSKSRYKRKK----

gi|29427946|sp|Q96GQ7|DDX27_HU      FKSKSRYKRRK----

gi|7304081|gb|AAF59119.1|           FGGPRHAKKDKKK--

gi|17510559|ref|NP_490891.1|        FQKARVAHRMKTKKY

gi|6323021|ref|NP_013093.1|         ---------------