S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Misc.

Protein Dhh1p
YDL160C
cgh-1 me31B DDX6 RCK
p54 / DDX6
X.laevis XP54
Database
Links
Cellular
Function
  • Translation
  • RNA decay
RNA decay

Group Alignment

gi|1709532|M.M._rck       MSTARTENPVIMGLSSQNGQLRGPVKASAGPGGGGTQPQPQLNQLKNTSTINNGTPQQAQ

gi|458727|H.S._RCK        -----------MGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQ

gi|17552114|C.E._rck      -----------------------------MSGAE---------QQQIVPANNG-------

gi|41712743|D.M._rck      -----------------------MMTEKLNSGHTNLTSKGIINDLQIAGNTSD-------

gi|1431254|S.C._DHH1      ------------------------------MGSIN-------NNFNTNNNSNT-------

                                                         *           : :     .       

 

gi|1709532|M.M._rck       SMAATIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPS

gi|458727|H.S._RCK        SMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPS

gi|17552114|C.E._rck      --------DENWKAGLNLPAKDRRFKTADVTDTKGVEFEDFCLGRDLLMGIFEKGWEKPS

gi|41712743|D.M._rck      --------DMGWKSKLKLPPKDNRFKTTDVTDTRGNEFEEFCLKRELLMGIFEKGWERPS

gi|1431254|S.C._DHH1      ------DLDRDWKTALNIPKKDTRPQTDDVLNTKGNTFEDFYLKRELLMGIFEAGFEKPS

                                  . .**  *::* ** * :* ** .*:*  **:: * *:******* *:*:**

 

gi|1709532|M.M._rck       PIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQV

gi|458727|H.S._RCK        PIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQV

gi|17552114|C.E._rck      PIQEASIGVALTGQDILARAKNGTGKTGAYCIPVIEKIQPALKAIQAMVIVPTRELALQT

gi|41712743|D.M._rck      PIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQIDPTKDYIQALVMVPTRELALQT

gi|1431254|S.C._DHH1      PIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQT

                          **** :* :*::*:*:**********:.*: ** :*::.   . ***:::*********.

 

gi|1709532|M.M._rck       SQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHV

gi|458727|H.S._RCK        SQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHV

gi|17552114|C.E._rck      SQICVELSKHIQ-LKVMVTTGGTDLRDDIMRLNGTVHLVIATPGRILDLMEKGVAKMEHC

gi|41712743|D.M._rck      SQICIELAKHLD-IRVMVTTGGTILKDDILRIYQKVQLIIATPGRILDLMDKKVADMSHC

gi|1431254|S.C._DHH1      SQVVRTLGKHCG-ISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDC

                          **:   :.**      *.***** *:***:*:  .*::::.****:*** .: **.:..

 

gi|1709532|M.M._rck       QMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINL

gi|458727|H.S._RCK        QMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINL

gi|17552114|C.E._rck      KTLVLDEADKLLSQDFQGILDRLINFLPKERQVMLYSATFPNTVTSFMQKHMHKPYEINL

gi|41712743|D.M._rck      RILVLDEADKLLSLDFQGMLDHVILKLPKDPQILLFSATFPLTVKNFMEKHLREPYEINL

gi|1431254|S.C._DHH1      SLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINL

                            :::*****:** **  ::: ::  **   * :*:***** :* .** .*:::******

 

gi|1709532|M.M._rck       MEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYS

gi|458727|H.S._RCK        MEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYS

gi|17552114|C.E._rck      MEELTLLGVTQYYAFVQEKQKVHCLNTLFRKLQINQSIIFCNSTQRVELLAKKITEIGYS

gi|41712743|D.M._rck      MEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYC

gi|1431254|S.C._DHH1      MEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYS

                          ****** *:*****:* *:**:******* :*****:******::*********:::**.

 

gi|1709532|M.M._rck       CFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLH

gi|458727|H.S._RCK        CFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLH

gi|17552114|C.E._rck      CYYIHSKMAQNHRNRVFHDFRQGNCRNLVCSDLLTRGIDIQAVNVVINFDFPRNAETYLH

gi|41712743|D.M._rck      CYYIHAKMAQAHRNRVFHDFRQGLCRNLVCSDLFTRGIDVQAVNVVINFDFPRMAETYLH

gi|1431254|S.C._DHH1      CYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLH

                          *:* *::* * .**:***:**:*  *.***:**:*****:************: ******

 

gi|1709532|M.M._rck       RIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVA---------

gi|458727|H.S._RCK        RIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVA---------

gi|17552114|C.E._rck      RIGRSGRFGHLGVAINLITYEDRHTLRRIEQELRTRIEPIPKTVDPKLYVA---------

gi|41712743|D.M._rck      RIGRSGRFGHLGIAINLITYEDRFDLHRIEKELGTEIKPIPKVIDPALYVAN----VGAS

gi|1431254|S.C._DHH1      RIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVAENDETVPVP

                          ************:*****.::**. *  **::* *.* .**  :*  ****        

 

gi|1709532|M.M._rck       ------EYHSEPAEDEKP------------------------------------------

gi|458727|H.S._RCK        ------EYHSEPVEDEKP------------------------------------------

gi|17552114|C.E._rck      ------DQQLVDAADETTA-----------------------------------------

gi|41712743|D.M._rck      VGDTCNNSDLNNSANEEGNVSK--------------------------------------

gi|1431254|S.C._DHH1      FPIEQQSYHQQAIPQQQLPSQQQFAIPPQQHHPQFMVPPSHQQQQAYPPPQMPSQQGYPP

                                . .     ::                                           

 

gi|1709532|M.M._rck       -----------------

gi|458727|H.S._RCK        -----------------

gi|17552114|C.E._rck      -----------------

gi|41712743|D.M._rck      -----------------

gi|1431254|S.C._DHH1      QQEHFMAMPPGQSQPQY