S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein Ded1p
YOR204W
Y71H2AM.19 DDX3
CG9748 / bel
DDX3X DDX3X
Database Links
Protein Dbp1p
YPL119C
DDX3Y DDX3Y
Database Links
Protein PL10
D1Pas1
Database Links
Cellular Function
  • pre-mRNA splicing
  • Ribosome Biogenesis
  • Translation
  • RNA Export
  • Translation
  • pre-mRNA splicing

Group Alignment

sp|Q9VHP0|BEL_DROME        MSNAINQNGTGLEQQVAGLDLNGGSADYSGPITSKTSTNSVTGGVYVPPH
sp|P24784|DBP1_YEAST       --------MADLPQKVSNLSINNKENGGGG-----------GKSSYVPPH
sp|O00571|DDX3X_HUMAN      MSHVAVENALGLDQQFAGLDLNSSDNQ-SG-------GSTASKGRYIPPH
sp|Q62167|DDX3X_MOUSE      MSHVAVENALGLDQQFAGLDLNSSDNQ-SG-------GSTASKGRYIPPH
sp|O15523|DDX3Y_HUMAN      MSHVVVKNDPELDQQLANLDLNSEKQS-GG-------ASTASKGRYIPPH
sp|Q62095|DDX3Y_MOUSE      MSQVAAESTAGLDQQFVGLDLKSSDNQNGG-------GNTESKGRYIPPH
sp|P06634|DED1_YEAST       --------MAELSEQVQNLSINDN-NENG----------------YVPPH
sp|P16381|PL10_MOUSE       MSHVAEEDELGLDQQLAGLDLTSRDSQ-SG-------GSTASKGRYIPPH
Q4W5R4|Q4W5R4_CAEEL        -----------MESNQSNNGGSGNAALNRG-------------GRYVPPH
                                      : .:  . . ..                         *:
 
sp|Q9VHP0|BEL_DROME        LRGGGGNNNAADAESQGQGQGQGQGFDSRSGNPRQETRDPQQSRGGGGEY
sp|P24784|DBP1_YEAST       LRSRGKPSFERSTPKQEDKVTGGDFFRRAGRQTGNNGGFFGFSK------
sp|O00571|DDX3X_HUMAN      LRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFS------
sp|Q62167|DDX3X_MOUSE      LRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRGDSRGKSSFFG------
sp|O15523|DDX3Y_HUMAN      LRNREASKGFHDKDSSGWSCSKDKDAYSSFGSR-DSRGKPGYFS------
sp|Q62095|DDX3Y_MOUSE      LRNRETSKGVCDKDSSGWSCSKDKDAYSSFGS-RDSRGKPNYFS------
sp|P06634|DED1_YEAST       LRGKPRSAR---NNSSNYNNNNGGYNGGRGGGSFFSNNRRGGYGN-----
sp|P16381|PL10_MOUSE       LRNREAAKAFYDKDGSRWS--KDKDAYSSFGSRSDTRAKSSFFS------
Q4W5R4|Q4W5R4_CAEEL        LRGGDGGAAAAASAGGGNRGYNNNRGGGGGGYNRQDRGDGGSSN-----F
                                                 ..                          
 
sp|Q9VHP0|BEL_DROME        RRGGGGGGRGFNRQSGDYGYGSGGGGRRGGGGRFEDNYNGGEFDSRRGGD
sp|P24784|DBP1_YEAST       -ERNGGTSANYNRGGSSNYKSSGNRWVNGKHIPGPK--------------
sp|O00571|DDX3X_HUMAN      DRG-SGSRGRFDDRGRSDYDGIGSRGDRSGFGKFER--------------
sp|Q62167|DDX3X_MOUSE      DRG-SGSRGRFDDRGRGDYDGIGGRGDRSGFGKFER--------------
sp|O15523|DDX3Y_HUMAN      ERG-SGSRGRFDDRGRSDYDGIGNR-ERPGFGRFER--------------
sp|Q62095|DDX3Y_MOUSE      DRG-SGSRGRFDDHGRNDYDGIGGRD-RTGFGKFER--------------
sp|P06634|DED1_YEAST       -----GGFFGGNNGGSRSNGRSGGRWIDGKHVPAPR--------------
sp|P16381|PL10_MOUSE       DRGGSGSRGRFDERGRSDYESVGSRGGRSGFGKFER--------------
Q4W5R4|Q4W5R4_CAEEL        SRGGYNNRDEGSDNRGSGRSYNNDRRDNGGDGQNTR--------------
                                      .          ..                          
 
sp|Q9VHP0|BEL_DROME        WNRSGGGGGGGRGFGRGPSYRGGGGGSGSNLNEQTAEDGQAQQQQQPRND
sp|P24784|DBP1_YEAST       -------------------------------------------NAKLEAE
sp|O00571|DDX3X_HUMAN      -------------------------------------GGNSRWCDKSDED
sp|Q62167|DDX3X_MOUSE      -------------------------------------GGNSRWCDKSDED
sp|O15523|DDX3Y_HUMAN      -------------------------------------SGHSRWCDKSVED
sp|Q62095|DDX3Y_MOUSE      -------------------------------------SGHSRWSDRSDED
sp|P06634|DED1_YEAST       -------------------------------------------NEKAEIA
sp|P16381|PL10_MOUSE       -------------------------------------GGNSRWCDKADED
Q4W5R4|Q4W5R4_CAEEL        -------------------------------------WNNLDAPPSRGTS
                                                                             
 
sp|Q9VHP0|BEL_DROME        RWQEPERPAGFDGSEGGQSAGGNRSYNNRGERGGGGYNSRWKEGGGSNVD
sp|P24784|DBP1_YEAST       LFGVHDDPD-----------------------------------------
sp|O00571|DDX3X_HUMAN      DWSKPLPPS-----------------------------------------
sp|Q62167|DDX3X_MOUSE      DWSKPLPPS-----------------------------------------
sp|O15523|DDX3Y_HUMAN      DWSKPLPPS-----------------------------------------
sp|Q62095|DDX3Y_MOUSE      DWSKPLPPS-----------------------------------------
sp|P06634|DED1_YEAST       IFGVPEDPN-----------------------------------------
sp|P16381|PL10_MOUSE       DWSKPLPPS-----------------------------------------
Q4W5R4|Q4W5R4_CAEEL        KWENRGARD-----------------------------------------
                            :                                                
 
sp|Q9VHP0|BEL_DROME        YTKLGARDERLEVELFGVGNTGINFDKYEDIPVEATGQNVPPNITSFDDV
sp|P24784|DBP1_YEAST       -----------------YHSSGIKFDNYDNIPVDASGKDVPEPILDFSSP
sp|O00571|DDX3X_HUMAN      --------ERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDV
sp|Q62167|DDX3X_MOUSE      --------ERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDV
sp|O15523|DDX3Y_HUMAN      --------ERLEQELFSGGNTGINFEKYDDIPVEATGSNCPPHIENFSDI
sp|Q62095|DDX3Y_MOUSE      --------ERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIENFSDI
sp|P06634|DED1_YEAST       -----------------FQSSGINFDNYDDIPVDASGKDVPEPITEFTSP
sp|P16381|PL10_MOUSE       --------ERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDV
Q4W5R4|Q4W5R4_CAEEL        --------ERIEQELFSGQLSGINFDKYEEIPVEATGDDVPQPISLFSDL
                                               :**:*::*::***:*:*.: *  *  * . 
 

sp|Q9VHP0|BEL_DROME        QLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFL
sp|P24784|DBP1_YEAST       PLDELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFL
sp|O00571|DDX3X_HUMAN      EMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFL
sp|Q62167|DDX3X_MOUSE      EMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFL
sp|O15523|DDX3Y_HUMAN      DMGEIIMGNIELTRYTRPTPVQKHAIPIIKGKRDLMACAQTGSGKTAAFL
sp|Q62095|DDX3Y_MOUSE      EMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFL
sp|P06634|DED1_YEAST       PLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFL
sp|P16381|PL10_MOUSE       EMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFL
Q4W5R4|Q4W5R4_CAEEL        SLHEWIEENIKTAGYDRPTPVQKYSIPALQGGRDLMSCAQTGSGKTAAFL
                            :   :  *:  : : :******:::* :   ****:*********..**
 
sp|Q9VHP0|BEL_DROME        VPILNQMYELG---HVPPPQSTRQYSRRKQYPLGLVLAPTRELATQIFEE
sp|P24784|DBP1_YEAST       FPLFTELFRSGPSPVP---EKAQSFYSRKGYPSALVLAPTRELATQIFEE
sp|O00571|DDX3X_HUMAN      LPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEE
sp|Q62167|DDX3X_MOUSE      LPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEE
sp|O15523|DDX3Y_HUMAN      LPILSQIYTDGPGEALKAVKENGRYGRRKQYPISLVLAPTRELAVQIYEE
sp|Q62095|DDX3Y_MOUSE      LPILSQIYTDGPGEALKAMKENGRYGRRKQYPISLVLAPTRELAVQIYEE
sp|P06634|DED1_YEAST       FPVLSESFKTGPSPQP---ESQGSFYQRKAYPTAVIMAPTRELATQIFDE
sp|P16381|PL10_MOUSE       LPILSQIYTDGPGEALRAMKENGKYGRRKQYPISLVLAPTRELAVQIYEE
Q4W5R4|Q4W5R4_CAEEL        VPLVNAILQDGPDAVHRSVTSSG--GRKKQYPSALVLSPTRELSLQIFNE
                           .*:..     *         .      :* ** .::::*****: **::*
 
sp|Q9VHP0|BEL_DROME        AKKFAYRSRMRPAVLYGG-NNTSEQMRELDRGCHLIVATPGRLEDMITRG
sp|P24784|DBP1_YEAST       ARKFTYRSWVRPCVVYGG-APIGNQMREVDRGCDLLVATPGRLNDLLERG
sp|O00571|DDX3X_HUMAN      ARKFSYRSRVRPCVVYGG-ADIGQQIRDLERGCHLLVATPGRLVDMMERG
sp|Q62167|DDX3X_MOUSE      ARKFSYRSRVRPCVVYGG-AEIGQQIRDLERGCHLLVATPGRLVDMMERG
sp|O15523|DDX3Y_HUMAN      ARKFSYRSRVRPCVVYGG-ADIGQQIRDLERGCHLLVATPGRLVDMMERG
sp|Q62095|DDX3Y_MOUSE      ARKFSYRSRVRPCVVYGG-ADTVQQIRDLERGCHLLVATPGRLVDMMERG
sp|P06634|DED1_YEAST       AKKFTYRSWVKACVVYGG-SPIGNQLREIERGCDLLVATPGRLNDLLERG
sp|P16381|PL10_MOUSE       ARKFSYRSRVRPCVVYGG-ADIGQQIRDLERGCHLLVATPGRLVDMMERG
Q4W5R4|Q4W5R4_CAEEL        SRKFAYRTPITSALLYGGRENYKDQIHKLRLGCHILIATPGRLIDVMDQG
                           ::**:**: : ..::***     :*::.:  **.:::****** *:: :*
 
sp|Q9VHP0|BEL_DROME        KVGLENIRFLVLDEADRMLDMGFEPQIRRIVEQLNMPPTGQRQTLMFSAT
sp|P24784|DBP1_YEAST       KVSLANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSAT
sp|O00571|DDX3X_HUMAN      KIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT
sp|Q62167|DDX3X_MOUSE      KIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT
sp|O15523|DDX3Y_HUMAN      KIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT
sp|Q62095|DDX3Y_MOUSE      KIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT
sp|P06634|DED1_YEAST       KISLANVKYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGERQTLMFSAT
sp|P16381|PL10_MOUSE       KIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSAT
Q4W5R4|Q4W5R4_CAEEL        LIGMEGCRYLVLDEADRMLDMGFEPQIRQIVECNRMPSKEERITAMFSAT
                            :.:   ::*******************:***   *..   * * *****
 
sp|Q9VHP0|BEL_DROME        FPKQIQELASDFLSN-YIFLAVGRVGSTSENITQTILWVYEPDKRSYLLD
sp|P24784|DBP1_YEAST       FPVDIQHLARDFLDN-YIFLSVGRVGSTSENITQRILYVDDMDKKSALLD
sp|O00571|DDX3X_HUMAN      FPKEIQMLARDFLDE-YIFLAVGRVGSTSENITQKVVWVEESDKRSFLLD
sp|Q62167|DDX3X_MOUSE      FPKEIQMLARDFLDE-YIFLAVGRVGSTSENITQKVVWVEEIDKRSFLLD
sp|O15523|DDX3Y_HUMAN      FPKEIQMLARDFLDE-YIFLAVGRVGSTSENITQKVVWVEDLDKRSFLLD
sp|Q62095|DDX3Y_MOUSE      FPKEIQMLARDFLDE-YIFLAVGRVGSTSENITQKVVWVEELDKRSFLLD
sp|P06634|DED1_YEAST       FPADIQHLARDFLSD-YIFLSVGRVGSTSENITQKVLYVENQDKKSALLD
sp|P16381|PL10_MOUSE       FPKEIQMLARDFLDE-YIFLAVGRVGSTSENITQKVVWVEEADKRSFLLD
Q4W5R4|Q4W5R4_CAEEL        FPKEIQLLAQDFLKENYVFLAVGRVGSTSENIMQKIVWVEEDEKRSYLMD
                           ** :** ** ***.: *:**:*********** * :::* : :*:* *:*
 
sp|Q9VHP0|BEL_DROME        LLSSIRDGPEYTKDSLTLIFVETKKGADSLEEFLYQCNHPVTSIHGDRTQ
sp|P24784|DBP1_YEAST       LLSAEH-------KGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQ
sp|O00571|DDX3X_HUMAN      LLNATG------KDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQ
sp|Q62167|DDX3X_MOUSE      LLNATG------KDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQ
sp|O15523|DDX3Y_HUMAN      ILGATG------SDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQ
sp|Q62095|DDX3Y_MOUSE      LLNATG------KDSLTLVFVETKKGADSLENFLFQERYACTSIHGDRSQ
sp|P06634|DED1_YEAST       LLSAST-------DGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQ
sp|P16381|PL10_MOUSE       LLNATG------KDSLILVFVETKKGADSLEDFLYHEGYACTSIHGDRSQ
Q4W5R4|Q4W5R4_CAEEL        LLDATG------DSSLTLVFVETKRGASDLAYYLNRQNYEVVTIHGDLKQ
                           :*.:         ..* *:*****: *..*  :*    .  .:**** .*
 

sp|Q9VHP0|BEL_DROME        KEREEALRCFRSGDCPILVATAVAARGLDIPHVKHVINFDLPSDVEEYVH
sp|P24784|DBP1_YEAST       AERERALSAFKANVADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVH
sp|O00571|DDX3X_HUMAN      RDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVH
sp|Q62167|DDX3X_MOUSE      RDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVH
sp|O15523|DDX3Y_HUMAN      RDREEALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVH
sp|Q62095|DDX3Y_MOUSE      KDREEALHQFRSGRKPILVATAVAARGLDISNVKHVINFDLPSDIEEYVH
sp|P06634|DED1_YEAST       SERERALAAFRSGAATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVH
sp|P16381|PL10_MOUSE       RDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVH
Q4W5R4|Q4W5R4_CAEEL        FEREKHLDLFRTGTAPILVATAVAARGLDIPNVKHVINYDLPSDVDEYVH
                            :**. *  *::.   :*************.:* ****:*****:::***
 
sp|Q9VHP0|BEL_DROME        RIGRTGRMGNLGVATSFFNEKNRNICSDLLELLIETKQEIPSFMEDMSSD
sp|P24784|DBP1_YEAST       RIGRTGRAGNTGVATSFFNSNNQNIVKGLMEILNEANQEVPTFLSDLSRQ
sp|O00571|DDX3X_HUMAN      RIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYE
sp|Q62167|DDX3X_MOUSE      RIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFE
sp|O15523|DDX3Y_HUMAN      RIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLVEAKQEVPSWLENMAYE
sp|Q62095|DDX3Y_MOUSE      RIGRTGRVGNLGLATSFFNERNLNITKDLLDLLVEAKQEVPSWLESMAYE
sp|P06634|DED1_YEAST       RIGRTGRAGNTGLATAFFNSENSNIVKGLHEILTEANQEVPSFLKDAMMS
sp|P16381|PL10_MOUSE       RIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFE
Q4W5R4|Q4W5R4_CAEEL        RIGRTGRVGNVGLATSFFNDKNRNIARELMDLIVEANQELPDWLEGMSGD
                           ******* ** *:**:***..* **   * ::: *::**:* ::..   .
 
sp|Q9VHP0|BEL_DROME        RGHGGAKRAGRGGGGRYGGGFGSRDYRQSSGGGGGGRSGPPPRSGGSGSG
sp|P24784|DBP1_YEAST       NSRGGRTRG--GGGFFNSRNNGSRDYRKHGGNGSFGSTRPRNTGTSNWGS
sp|O00571|DDX3X_HUMAN      HHYKGSSRG-RSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGG
sp|Q62167|DDX3X_MOUSE      HHYKGSSRG-RSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGG
sp|O15523|DDX3Y_HUMAN      HHYKGGSRG-RSKSNRFSGGFGARDYRQSSGSSSSGFGASRGSSSRSGGG
sp|Q62095|DDX3Y_MOUSE      HHYKGSSRG-RSK-SRFSGGFGARDYRQSSGSANAGFNSNRANSSRSSGS
sp|P06634|DED1_YEAST       -APGSRSNS--RRGGFGRNNNRDYRKAGGASAGGWGSSRSRDNSFRGGSG
sp|P16381|PL10_MOUSE       HHYKGGSRG-RSKS-RFSGGFGARDYRQSSGASSSSFSSGRASNSRSGGG
Q4W5R4|Q4W5R4_CAEEL        MRSGGGYRG--RGGRGNGQRFGGRDHRYQGGSGNGGGGNGGGGGFGGGGQ
                               .  ..                    .. .. .       .  . . 
 
sp|Q9VHP0|BEL_DROME        GGGGSYRSNGNSYGGNSGGGGYYGGGAGGGSYGGSYGGGSASHSSNAPDW
sp|P24784|DBP1_YEAST       IGGGFRNDNEKNGYGNSNAS-----------------------------W
sp|O00571|DDX3X_HUMAN      GHGSSRGFGGGGYGGFYNSDGYGG-----------------NYNSQGVDW
sp|Q62167|DDX3X_MOUSE      GHGGSRGFGGGGYGGFYNSDGYGG-----------------NYNSQGVDW
sp|O15523|DDX3Y_HUMAN      GYGNSRGFGGGGYGGFYNSDGYGG-----------------NYNSQGVDW
sp|Q62095|DDX3Y_MOUSE      SHN--RGFGGGGYGGFYNNDGYGG-----------------NYNSQAVDW
sp|P06634|DED1_YEAST       WGSDSKSSGWGNSGGSNNSS-----------------------------W
sp|P16381|PL10_MOUSE       SHGSSRGFGGGSYGGFYNSDGYGG-----------------NYSSQGVDW
Q4W5R4|Q4W5R4_CAEEL        RSGGGGGFQSGGGGGRQQQQQQRAQ--------------------PQQDW
                             .        .  *                                  *
 
sp|Q9VHP0|BEL_DROME        WAQ
sp|P24784|DBP1_YEAST       W--
sp|O00571|DDX3X_HUMAN      WGN
sp|Q62167|DDX3X_MOUSE      WGN
sp|O15523|DDX3Y_HUMAN      WGN
sp|Q62095|DDX3Y_MOUSE      WGN
sp|P06634|DED1_YEAST       W--
sp|P16381|PL10_MOUSE       WGN
Q4W5R4|Q4W5R4_CAEEL        WS-
                           *