S. cerevisiae

C.elegans

Drosophila

Mus Musculus

H.sapiens

Protein DDX59 DDX59
Database Links
Cellular Function

Group Alignment

Q5T1V6|DDX59_HUMAN.      MFVPRSLKIKRNANDDGKSCVAKIIKPDPEDLQLDKSRDVPVDAVATEAATIDRHISESC
Q9DBN9|DDX59_MOUSE.      MFVPRSLKIKRSSNDDLKSGEAKKSKPEAGGLQVEGDRDTPVHTSVTEEAVTADKPGHAS
                         ***********.:*** **  **  **:. .**:: .**.**.: .** *.   : ..:.
 
Q5T1V6|DDX59_HUMAN.      PFPSPGGQLAEVHSVSPEQGAKDSHPSEEPVKSFSKTQRWAEPGEPICVVCGRYGEYICD
Q9DBN9|DDX59_MOUSE.      STNSPSCQLAEVSSTGPDEGVKDSHPSEEPVKSFSKTQRWPEPGEPVCVVCGRYGEYICD
                         .  **. ***** *..*::*.*******************.*****:*************
 
Q5T1V6|DDX59_HUMAN.      KTDEDVCSLECKAKHLLQVKEKEEKSKLSNPQKADSEPESPLNASYVYKEHPFILNLQED
Q9DBN9|DDX59_MOUSE.      KTDEDVCSLECKAKHLLQVKEGEGSLRPSSPQRVAAEPESPLDAFYVYKEHPFIVTLKED
                         ********************* * . : *.**:. :******:* *********:.*:**
 
Q5T1V6|DDX59_HUMAN.      QIENLKQQLGILVQGQEVTRPIIDFEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLG
Q9DBN9|DDX59_MOUSE.      QIETLKQQLGISVQGQDVARPIIDFEHCGFPETLNQNLKKSGYEVPTPIQMQMIPVGLLG
                         ***.******* ****:*:*********.:**.**:************************
 
Q5T1V6|DDX59_HUMAN.      RDILASADTGSGKTAAFLLPVIMRALFESKTPSALILTPTRELAIQIERQAKELMSGLPR
Q9DBN9|DDX59_MOUSE.      RDILASADTGSGKTAAFLLPVIIRAFSEDKTPSALILTPTRELAIQIERQAKELMSGLPR
                         **********************:**: *.*******************************
 
Q5T1V6|DDX59_HUMAN.      MKTVLLVGGLPLPPQLYRLQQHVKVIIATPGRLLDIIKQSSVELCGVKIVVVDEADTMLK
Q9DBN9|DDX59_MOUSE.      MKTVLLVGGLPLPPQLYRLRQHVKVIIATPGRLLDIIKQSSVSLSGIKIVVVDEADTMLK
                         *******************:**********************.*.*:*************
 
Q5T1V6|DDX59_HUMAN.      MGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQI
Q9DBN9|DDX59_MOUSE.      MGFQQQVLDVLEHTPGDCQTILVSATIPDSIEQLTDQLLHNPVRIITGDKNLPCASVRQI
                         *********:**: *.************ *****:.************:******.****
 
Q5T1V6|DDX59_HUMAN.      ILWVEDPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKS
Q9DBN9|DDX59_MOUSE.      ILWVEDPAKKKKLFEILNDQKLFKPPVLVFVDCKLGADLLSEAVQKITGLNSTSIHSEKS
                         *******************:******************************:* *******
 
Q5T1V6|DDX59_HUMAN.      QIERKNILKGLLEGDYEVVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLG
Q9DBN9|DDX59_MOUSE.      QVERRDILKGLLEGDYEVVVSTGVLGRGLDLVNVKLVVNFDMPSSMDEYVHQVGRVGRLG
                         *:**::*************************:.*:*****************:*******
 
Q5T1V6|DDX59_HUMAN.      QNGTAITFINNNSKRLFWDIAKRVKPTGSILPPQLLNSPYLHDQKRKEQQKDKQTQNDLV
Q9DBN9|DDX59_MOUSE.      QNGTAITFINNNSKRLFWDVAKRVKPTGSILPPQLLNSPYLHEQKRKEQQKDRQTQNSLV
                         *******************:**********************:*********:****.**
 
Q5T1V6|DDX59_HUMAN.      TGANLMDIIRKHDKSNSQK
Q9DBN9|DDX59_MOUSE.      TGANLMDIIRKHEKSSSQK
                         ************:**.***